KEGG   Zygosaccharomyces rouxii: ZYRO0C15862gHelp
Entry
ZYRO0C15862g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     ZYRO0C15862g
Protein kinases [BR:zro01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   ZYRO0C15862g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:1239992..1241305
Genome map
AA seq 437 aa AA seqDB search
MDFSNVFGNNRNVLNWQQRDPKQDWKYYRYKPSADRIKSLLTTQPEKKISKEQEVAPRTI
VESAKFSMPARYELIQILGKGSYGTVCSIKDRQNPDAPYSIAVKKVTNIFYREILLKRAI
RELKFMNYFKGHKNIVSLINLEIVTEKPYDGVYCYQELIDYDLAKVIHSSVQLSEFHVKH
FFYQILCGLKYIHSADVIHRDLKPGNILCSLNGCLKICDFGLARGVAPQYFTTKESYHDI
TNYVATRWYRAPELILSHKAYSKAIDMWSVGCILAEFYGRKPVFMGKDSVHQIHEITKIL
GSPSKELLIHYGSLKAWNMCSNATPAYKNVPWSDVYPFASPDALDLIALLVQWEADQRLT
VEEAIEHYFLQEVRRPEDEPVCPQGPFDFSYEHQLCSMLKLREYLINEVMTFRQERAICD
PSTPEILKNIAVIEDPE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggatttttccaatgtctttggtaacaacagaaatgtgttgaattggcaacaaagagat
cctaagcaagattggaaatattatcggtacaaacctagtgccgatcgaattaaaagtttg
cttactacacaacctgagaaaaaaatttctaaggaacaagaagttgctcctaggacgatt
gttgaaagtgcgaaattttctatgccggccagatatgaattaattcaaatattggggaaa
ggctcttatggtactgtatgctcgattaaagacagacaaaatcccgatgcgccatattca
atagcggttaaaaaagtcacgaatatcttttacagagaaattcttttgaaaagggcaatt
agagaattaaagtttatgaattatttcaagggacataaaaacattgtcagtttaattaat
ttggaaattgttacagagaagccttatgacggtgtctactgctatcaagagttgatagac
tatgatctagccaaagtaattcattcatctgtacagttgtctgagttccatgtaaaacat
tttttctaccaaatcctttgtgggcttaaatacatccatagtgccgatgttatccatagg
gatttaaaacctggtaacatattatgttctttgaatggatgtttgaaaatttgtgatttt
ggtctagctagaggggttgcccctcagtattttaccacaaaggaatcatatcatgacatt
accaactatgtggctacacgttggtatagagcgccagaattgattttatcgcataaggca
tatagtaaggcgattgatatgtggtctgttggttgtatcttggcagaattttatggtaga
aaaccagtatttatgggcaaagattccgttcatcaaatacatgaaattacaaaaatttta
gggtccccctctaaggaattattgatccattatggatcattaaaagcatggaacatgtgt
agtaatgcgactccggcatacaagaatgttccctggtctgatgtttacccatttgcatca
ccagacgcactagatttaattgctctattggtacagtgggaggcagatcaaagactcact
gtggaggaggccattgaacactatttcttacaagaagtgagaaggccagaagatgaacca
gtgtgtccacaaggtccatttgacttctcttatgaacaccaattgtgctccatgcttaaa
ctgagagagtatcttatcaacgaagttatgacattcagacaagaaagggccatatgtgat
ccatccacgccagagattctaaagaacattgcggtgattgaagatccagaatga

DBGET integrated database retrieval system