KEGG   Zygosaccharomyces rouxii: ZYRO0C17886gHelp
Entry
ZYRO0C17886g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ZYRO0C17886g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ZYRO0C17886g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:1392718..1393716
Genome map
AA seq 332 aa AA seqDB search
MGITTIGSLNYDIVTFTDRVPQAGETLRGNTFETHAGGKGLNQTIALAKLKQTGAKYEIR
MVGSVGNDSFGKQLKDLLQESGVDTTKVQVIEKKSTGVATILVEQKNGGQNRIILTEGAN
GNSVYDDDDLKSIFQGVTLNNEKQFVVFQNEIPDPCSIISWIKINHPHFQIVYNPSPFYP
ITKEQWSLVDVLVINEVEALQIVKAIYEEKEYEFYAKEIEKDYVGGYKQICEEFQRHLVS
QTNSAIAVVTLGEKGSIYASKETPTVGFTPAVPDVNVVDTTAAGDIFLGALVTQLHQNVD
LETAIQFSTKASSIGIQKAGAAESIPTFEEVA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggtattactacaatcgggtcattgaactacgacatcgttactttcactgatagagta
ccgcaggccggagagactcttcgaggcaatacttttgagacccatgcaggtgggaaaggg
ttgaatcagaccattgctctcgccaaattgaaacagactggtgccaaatatgaaattaga
atggttggtagtgtcggaaatgactcctttggtaaacaattaaaagatcttttacaagaa
agtggcgtagacactaccaaggttcaagttatagaaaagaaaagtactggtgtggccaca
attctagtggaacagaaaaacggtggacaaaatagaattattctcaccgaaggtgccaat
ggtaatagcgtctatgacgatgatgacttgaaatctatcttccaaggggtcactctcaac
aatgaaaaacaatttgtggtattccagaatgaaattccagatccatgctctatcatttct
tggattaagataaaccatccccatttccaaattgtctacaatccctctccattctatccg
atcactaaggagcaatggtctttggtggatgtactcgtaattaatgaagtggaagctcta
caaatcgtgaaagccatctatgaggagaaggaatatgaattttacgccaaagagatcgaa
aaagactatgtaggaggttacaaacaaatttgtgaggaatttcagcgtcatttggtgagc
caaaccaattctgctattgccgtcgtgacgttgggtgaaaagggctccatttacgcttcg
aaagaaactcctaccgttggatttacccctgccgtcccagacgtgaatgtggtggacact
accgctgccggtgatatatttttaggcgctctggtaacacaattgcaccagaatgttgac
ctggagactgcaattcagttttctacaaaggctagttctattggaattcaaaaagcaggt
gccgctgagagcatccccacattcgaggaagtcgcctga

DBGET integrated database retrieval system