KEGG   Zygosaccharomyces rouxii: ZYRO0C17908gHelp
Entry
ZYRO0C17908g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
zro  Zygosaccharomyces rouxii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(1393864..1397478)
Genome map
AA seq 1204 aa AA seqDB search
MVDDSGDSHSILENDAVGSPRENTIDDEAFPTLENQRNIITQLVNENQENAKEGDSVYII
PQFWYANFFDPQTIDPTQLGPIDTALICRDYRNFILVEYDKCPYISIPEPVFVKLVNWYG
LANDSQPVSTHLVYDENHNLITEYNQCVFRVHHLVESDQDRRHGGGLNKRVSYFAISRLC
TVKQLSIKILDTFFERESDLDVSKAKFKIWFVKYSEQVGSNSILNSSFKLDPLQFMELPL
HRRITPLLFHHTLKEVDILTGDFVVELRQYNKNYHWLSNYFMYNQLTPSSGITGLYNLGN
TCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGYVARAFSGLVQNLFGCKTLS
SGSTLTPAYSPTGFKSTIGHFNSMFSGYMQQDSQEFITFLLDGLHEDLNRIVDKPYIEKP
SLSPEDDSNDFNVIKRLAEDTWKLHLQRNDSVITDLFVGLYESTLQCPECNNVSITFDPY
NDLTLPLPVNTVWHCKVKVFPQNSPPCVLEVEMGKSSTYQNLKEYVAKYANIEPRNLYGC
EIFSHQFYNNYESPESNSQFLPIQELISESDDVIFYEIVASQNDTIVPILNSRIEEGFKN
PRLFGVPFFIVLSPEERVNPGAIRYKLEKYFSHLSGGFVEFPSLSEMENHSLPTLPLLRE
KYPEYTFDEYQEFLKYAVKEDIGTIDTHFKIKTIEETTTENEDDPNQQILPDNANQLPRF
WTPYSPINVNRAKDISESLNPVVRDIYDYPSLLQAAKGPTMDDNGSNEQKDKVSDLQTEP
TTAQDSDIDLENAQEEQQDENSVDSEPNEATTQNTNDNNDNQIIPLVNSQTFIVCEWSES
AIQEVFSEDKLINWEKPAELKNTQLEVERQKRQQEEEKKITLHDCLKLFSKREVLGMNDS
WYCPSCKEHRQATKQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLV
NKGDPRGTIYDLVAVDNHYGGLGGGHYTAYAKNVDDSKWYYFDDSRVTETTPERGIASSA
YLLFYVRRTADGKCGTHELQELIQKSRKNYDDRIRQMYDRQRMLFESNKTDSEEIADIEE
DSSKIEQPREEDTPDGRVDSGDSGDSSEANGSTSSHENSVSARSADYSVRSLEVGRLQPR
ESLDENENNMSRRKLRILNKTYNEPSIAHSPASSVSSDGTDSISAALSQAKSGNDNILRS
PTKD
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgattcaggtgatagccattcgatccttgagaatgatgcggtaggttcacca
agggaaaacacaattgacgatgaagctttccccactttggagaatcaaaggaatataatc
acacaattggtaaatgaaaaccaagaaaatgcaaaggaaggagacagcgtatatattatc
ccacaattttggtatgcaaattttttcgaccctcagactatagatcctacccagctagga
cctatagatactgcgctaatttgtagggattatcggaatttcatactggttgaatacgat
aaatgtccctacatttcaatacccgaacctgtgtttgtcaagttagtgaattggtatggt
ttggctaatgactcacaaccggtgagcacacatctggtttatgatgaaaaccacaactta
attacagagtacaatcaatgcgttttcagagtacatcacttggtggaaagcgatcaggat
aggcgacatggtggaggtcttaacaaaagggtgtcatattttgcaatctcaagattatgt
acagtcaaacagttatcaatcaagatcctcgataccttttttgagagggaatcagattta
gatgtttccaaggctaaattcaaaatatggttcgttaagtattctgagcaagttggttcc
aatagtattctaaattcatcctttaagctggatccattgcaatttatggaattacccctc
cacagaagaatcacccctctgttattccatcatactttgaaagaagtcgatattctgacg
ggtgatttcgtagtggaattaaggcagtacaacaagaactatcattggctttccaactac
ttcatgtacaatcaattgacaccttcgagcggtattactgggttatacaacttgggtaac
acttgttatatgaattccgctctgcaatgtctagtacacattcccgaattgagagactac
ttcctttacaattgttttgaggatgaaataaactgtaataatccgttggggtaccaagga
tatgtggctagagcatttagtggattagtgcagaatctgttcggctgcaagactttatcg
agtggttctacgctgacgccggcatattcaccaacaggttttaaaagcacaataggtcat
ttcaatagtatgttttcaggctacatgcaacaagattctcaggagttcataactttcctt
ttggatgggctacatgaagatttgaataggattgtcgataaaccgtacattgaaaagcct
tcattgtcccccgaggatgacagtaacgacttcaatgtcatcaaaagattggcagaggat
acctggaaattacatttacaaagaaacgattctgtcatcaccgatttatttgtcggactt
tacgagtctacattacaatgtccagagtgtaataacgtctccataacatttgatccctac
aatgatttaactcttcctctccccgtgaatacggtttggcattgcaaagttaaggttttt
ccacagaattccccaccatgtgttttagaagtggaaatgggtaagtcatctacatatcaa
aatttaaaggagtacgttgcaaagtatgccaatatagaaccaaggaatttgtatggatgt
gaaatctttagtcaccagttctacaacaattacgaatccccagaatcaaactctcaattc
ttacccattcaagagcttatttcagaatctgacgatgtaatattttatgaaattgtggca
tcacaaaacgatacaattgttccgatattaaatagtcggattgaagaaggtttcaaaaat
cccagattattcggagttcccttctttattgtgctttcgccagaagaaagagtcaacccc
ggtgctattcgttacaagctcgagaagtatttttcgcatttaagtggaggatttgtagag
ttcccctcactgtctgaaatggaaaatcattcgttacccacccttccacttcttcgagag
aaatatccagaatatacttttgatgagtatcaggaatttttaaaatatgctgtcaaagaa
gacatcggcactattgacacccattttaagattaaaaccatcgaggaaactactactgaa
aatgaagatgatccaaatcaacaaatactaccagacaatgccaaccaattaccaaggttt
tggacaccatactctccgattaatgtaaatcgcgctaaggacatttctgaatcgctaaat
ccagtggtaagggatatttatgactatccatcgcttttgcaagctgcaaaaggcccaaca
atggatgacaatggatctaatgagcaaaaagataaagtcagcgacttgcaaacagaacct
accacagcacaagattcagatatagacttagagaatgctcaagaggaacagcaagatgaa
aattcagtagattcagagccgaacgaagccactacacagaatactaatgataataatgac
aatcaaataattcccctggtaaattcacagacttttattgtatgtgaatggtcagaatca
gctatccaggaagttttctctgaagataagttgataaactgggaaaagccagcagaatta
aagaatacacagttggaggtagagagacaaaaaagacagcaagaggaggaaaagaagatc
actctacatgactgtttaaagttgttctcgaaacgtgaggttttgggcatgaatgattcg
tggtactgcccctcatgtaaggaacacagacaggctacaaagcaaattcaactttgggac
actcctgatgtcctactaatacatttgaaaagatttgagaatttacgatctttcagcgat
aaaattgacgaagttgtccacttccccataacgggtctagatatgtcaccatacttggtt
aacaagggagatccaagagggaccatttacgatctagttgccgtggataatcattatggt
gggttaggtggtggtcattacactgcctatgcgaaaaatgttgatgattctaaatggtat
tatttcgatgattctcgtgttacggagaccacaccagagcgtggtattgctagttccgca
tatctactattctacgtgcgccgcactgctgatggaaaatgtggtacccatgagttacaa
gaacttatccagaaaagtcgtaagaattatgatgaccgtattagacaaatgtatgacaga
cagaggatgctgttcgaaagtaataagaccgacagcgaagagatcgctgacattgaggaa
gactctagcaagatagagcagcccagggaagaagatactccagatggcagagttgatagt
ggtgatagtggtgatagttcagaagccaatggtagcaccagttcgcatgaaaattctgtg
tcagcaagatcagccgattatagcgttagaagcttagaagttggtcgtctccaacctaga
gagtctcttgatgagaatgagaataatatgagtcgccgcaagcttagaatcttgaacaag
acttacaatgaaccctcaattgcacattcaccagcttcgtctgtgtcctctgatggtacc
gatagcataagtgctgcactttcccaagccaaatcggggaacgataatattctaagatcc
cctacaaaggattag

DBGET integrated database retrieval system