KEGG   Zygosaccharomyces rouxii: ZYRO0D00946gHelp
Entry
ZYRO0D00946g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ZYRO0D00946g
Enzymes [BR:zro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ZYRO0D00946g
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     ZYRO0D00946g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(72410..76984)
Genome map
AA seq 1524 aa AA seqDB search
MVLNRTVLLRLDSQGEPVVALSYGQGVLTLPSVPLPPGTPKGTPLFTVRLVVTAGSKVSR
DGLVWTNCPPDSETEFDRHKFYKKQIRATFHKDDKIDLDIFRPGPYCFYLSFRNRDGKLE
TTRKFYFVAPPILHVDGKLVKLDSVALQTVVSKWMGKNWDAVFERIAAKKYNMIHFTPLQ
RRGHSNSPYSIYDQLEFDPDHFSSTEEVKQMVHRLHTKYKALTLTDVVFNHTADNSKWLR
EHPESGYNAITAPHLIPAIELDGALLQFSKTMGQLGYPTDLHNSNDLDHVMEGIDVHVLQ
AIRLWEYYVVDVRGTLDQLQGYWNGLTTDPDLKLPLDSNSPVKEIARYVREHATVKPFGI
LGSRFVNKVDVIKFGSVLQKLYGKNWDRNILSKAEEILNELNLPLYKDHDNDVNEIRNQL
YNRIKYSKLDPSGPRQGPINDIFPLTEPYFTRFKADDGKDYALANNGWIWASDPLIDFAS
GESKAYLRREVIVWGDCVKLRYGKGPEDSPYLWKRISDYVTQSALIFDGFRIDNAHSTPL
HVGEYFLDLARKVNPNLYVVAELFSGSEQMDCLYVERLGLSCLIREAMQAWTESELSSLI
HKNGGRPIGSYRFVPMDNFSYDRDIQLNRNYCYHDASDGSMKCVSEIMIPRILTAVPPHA
LLMDCTHDNETPNQKRTVEDTLPNAALVALCSSAVGSNFGCDEIFPKLLNLVTESRTYDI
HDSPGIGKVKSLLNDIRKEINELSMDVEDSEAYVHHDGQYITFHRTDVKSGKGWYLIARM
KFGENQGDQKLEPQTFAHTTAKPLFAYSLEKTGEAPNDPKLLKGVPTKLVKLEGFKIQFN
ENSKITTISLPDYFPQGSIAVFETQHLGVDQSLDHFIRSGAIQATSGLDLIALNSVLYHS
DQEENDITDGSTGSYDVPNFGKLIYCGLQGWISVLRGIVFSNDLAHPLSENLREGTWALD
YLVGRLDHYRHEPGVAAVQDWLRSRFDRIKQLPFYLRPSYFALTVAIIYDTCRLRAVQLM
PTMIGKSTLFVQSLAMTSIQMVTRMKSTSIYPDHLVPSMAAGLPHFSTGWARCWGRDIFI
SLRGLLLTTGRFDIAEDHILAFAKTLKHGLIPNLLDSGKNPRYNARDAAWFFIQAVQDYI
DIVPNGESILQKKVTRRFPLDDTYVPVDDPRAFQHTSTIEEIIYEIFSRHANGIKYREAN
AGPQLDRVMSDQGFNVEVHVDWSTGFVHGGSQFNCGTWMDKMGESERAGSYGVPGTPRDG
AAVEIIGLLKSSLRFVNELSKKGLFKNIEVKRENGSQITFQEWEELVQNNFEKKFYIPED
PKDDEKYDIDSNLVNRRGIYKDLYHTGKPYEDYELRPNFTIAMTVAPELFTPELALGALN
IADKVIRGPIGMKTLDPSDYNYHPYYNNGEDSDDFATSKGRNYHQGPEWVFLYGYFLRAF
YSFHYKTNPACQSKKDKSPSSYLYQELSHRIDRLSKWIAESPWAGITELTNKDGEFCGDS
SPTQAWSTACLLDMYHDLWVSFEQ
NT seq 4575 nt NT seq  +upstreamnt  +downstreamnt
atggtattgaacaggactgttttactgagactagatagtcaaggtgaacctgtcgttgca
ctctcatatggtcaaggtgttttaaccctgccttctgtacctctacccccaggtactcct
aaagggacaccacttttcacagttagattggtggttaccgcaggatctaaggtatctaga
gatggtcttgtatggacgaattgcccacctgatagcgaaacggagttcgatagacacaag
ttttacaagaagcaaattcgtgccacttttcacaaggatgataagattgatttagatatc
tttagaccaggaccttactgtttctatctatcgtttagaaatagagacggtaaattagaa
actactaggaaattttactttgttgctccacccattctacacgtagatggtaagttggtt
aaattagattctgtggctttacaaacggtggtttccaaatggatgggtaaaaattgggat
gctgttttcgagaggattgccgccaaaaaatacaacatgattcatttcacacctttacag
cgtagaggtcactctaattctccttattccatctatgatcagttggaatttgatcctgat
cactttagtagcactgaggaagttaaacagatggtccataggttgcataccaaatacaag
gctttaaccttaacagatgtggtctttaaccatactgcagacaattctaagtggttgagg
gaacatccggaatctggttataatgctatcaccgctcctcatttgattcctgctatcgaa
ttggatggggctctattacaatttagtaaaacaatgggtcaactgggttaccccacggat
ttacacaattcaaacgacttagaccatgtgatggaaggaattgacgttcacgtgctacaa
gctatcagattatgggaatactacgtggttgatgttcgcggtactttggatcaattacag
ggatattggaatggactcaccacagaccctgatttaaaacttccattggattcaaattct
ccggtgaaagaaattgcccgctacgttcgtgaacatgcaactgttaaaccattcggtatc
ttgggttctcgttttgtcaacaaagtagatgtaattaaattcggatctgtcttgcaaaaa
ttgtacggaaagaattgggatcgaaacatcttgtccaaagctgaagaaattctgaacgaa
ctgaatttacctctttacaaggaccacgataacgatgttaatgaaattagaaatcaatta
tacaaccgtatcaaatattcgaagttggacccatcggggccaagacagggacccatcaac
gatatattccccttgacagaaccttatttcaccagatttaaagctgatgatggtaaggac
tatgcattggcaaataacggttggatctgggcaagtgaccccttgattgattttgcctct
ggtgaatccaaggcttatttgcgtagggaagttattgtttggggggactgtgttaaattg
aggtatggtaaaggtccagaggattcaccttacttgtggaaacgtatttctgattatgtg
actcaaagcgctttaatctttgatggttttagaattgacaatgcccattctacaccattg
cacgtcggtgaatactttttagatttggctagaaaggtcaatccaaatttatacgttgtg
gcagaattgttcagtggttctgaacaaatggattgtctttacgtggaacgtcttgggtta
tcatgtttgattagagaagctatgcaggcttggacagaaagtgaattatccagtttaatt
cataaaaatggcggcagaccaattggctcttacagatttgtacccatggacaacttctcc
tacgacagagatatacaactgaataggaactattgttaccatgatgcatctgacggatcc
atgaaatgtgtttctgagattatgattccgcgtattttgaccgcagtaccacctcatgct
ctactaatggattgtactcatgataatgaaactcctaaccaaaagagaaccgttgaggat
actttacctaatgcagctcttgtagcattatgctcttcagccgttggatctaattttggt
tgcgatgaaatcttcccaaagctattgaacttagttactgaatcaaggacttatgatatt
catgattctcccggtattggtaaagtgaaatctctacttaacgatatcagaaaggaaata
aatgaactgagtatggatgtggaagattctgaggcttatgtacatcacgatggacaatat
atcactttccatcgtactgatgtaaagtccggaaaaggttggtacttgatcgctagaatg
aaatttggtgaaaaccaaggtgatcaaaaattggaaccccaaaccttcgcccacactact
gccaaaccgttgtttgcctattctttggaaaaaactggtgaagctccaaatgatcccaag
ttattgaaaggtgttcctaccaaattagtcaagttggaaggtttcaaaatacagtttaat
gaaaattccaagattactactattagtctaccagattatttccctcaaggttctattgcg
gtttttgaaactcaacatttaggtgttgatcagagtttagatcactttatcagatccggt
gccatccaggccacaagtggattagacttaatcgcactaaactctgtgctataccattca
gaccaagaggagaatgatatcactgatggctctactggctcttacgatgtccctaatttc
ggtaaattgatttattgtggattacagggatggatttctgtacttaggggcattgtcttt
agcaacgatctagctcaccctttgagtgaaaacttgcgtgaaggtacttgggctcttgac
tatttggttggaagactggaccactatcgccacgaacccggcgttgccgctgtacaggac
tggttacgtagcagattcgacagaatcaaacaattgcctttctacttgagacccagttat
ttcgccctaacggtagctatcatatatgacacctgtcgtttgcgtgccgtacaattgatg
cctactatgattggcaaatctactttgtttgttcagagtttagcaatgacttctattcaa
atggtcacaaggatgaaatccacttcgatatacccagatcatctagtcccctccatggca
gcaggtttgccacacttcagcactgggtgggcaagatgttggggtagagatatcttcatt
tccctaagagggttgttgttaacgaccggtaggtttgatattgctgaagatcacatcctg
gcgtttgccaaaactttaaaacatgggttgatccccaacttgttagactctggtaaaaat
cctcgttacaacgctcgtgatgctgcatggttctttatccaagcggtccaagattacatt
gacatcgttcccaatggggaatcgattctgcaaaagaaagtcacaaggagattcccattg
gatgatacctacgtgcctgtggacgacccaagagcatttcaacataccagtactattgaa
gagatcatttatgaaatcttcagtagacatgcaaatggtatcaagtatagagaagccaac
gcaggtcctcaattggatagggtcatgtcagatcagggcttcaatgtggaagttcatgtc
gattggtctacaggttttgtccatggtggctcgcaattcaactgtggtacttggatggat
aaaatgggtgagagtgagcgtgctggttcttacggtgttcctggaacgccccgtgatggt
gccgctgttgaaatcattggtctattgaaaagttctctaagatttgtcaatgagttgagt
aagaagggtttgtttaagaatattgaagtaaagagggaaaatggttctcaaattactttc
caagaatgggaggaattggttcaaaacaatttcgagaagaaattctacattcccgaggat
cctaaggatgatgagaagtacgatatcgattccaacctggttaacagaagaggtatctac
aaggatctttaccatactggtaaaccatacgaagattatgaactaagacctaatttcacc
attgcgatgactgtcgcccccgaattgtttacgcctgaattggccctgggggcactcaac
attgctgataaggttattagaggtccaattggtatgaaaactttagatccaagcgattac
aactaccacccatactacaacaacggcgaagatagtgatgattttgcaacttctaaaggt
cgtaactatcaccaaggtcctgaatgggtttttttatacggttactttttgagagctttc
tacagtttccattacaagacaaacccggcatgtcaaagcaaaaaggataaaagtccttct
tcttacttgtaccaagaattgtctcacagaattgatcgtctctctaaatggatcgccgag
agcccctgggcaggtatcaccgagttgacaaacaaagatggagaattctgtggtgattcc
agtcctactcaagcctggagtactgcatgcctgttagacatgtatcacgacttatgggta
tcgtttgagcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system