KEGG   Zygosaccharomyces rouxii: ZYRO0D02772gHelp
Entry
ZYRO0D02772g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ZYRO0D02772g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ZYRO0D02772g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:218061..219920
Genome map
AA seq 619 aa AA seqDB search
MVSKEKRSKDSDSKMIEKKRSNSRGLGKLPLPLPLPLIAFVLFVCATYKYILPLKVEMVG
WPSQFSPPFNETNRIIIQDFFKPYDPSYPTSLPTTTYYRRINLRPLSAHRISRANFTLWL
EEQTSISFEKILENIGDSDINDLYQQNVAEGAVIASPSKDKPDYFFQWPRDAAITVNTVI
SNLMGSDNAINLTLAKTIVKYLNNSAILQRIPNPSGEGVGGTDPQLKGLGEPKFEVDNKA
FEGNWGRPQNDGAPLRLIATFHFLEKLAKQKIPLSQLLSNLKIDGLSFHDEDSLFENLIR
YDLEFVLNNWKVDSFDLWEEVKGRHFFTSLVQLSATKLGIDFMKSNPDRQKDPLLKELQR
TSTELNDFLTLEGGFLNPHKNYIVETPSSLNSRSGLDTAVLIASLLTHADDGETSPYNLP
FGVNDSGILNTLHALTSIMAIIYPVNHQRYSPRMGVALGRYPEDVYDGVNTSEGNPWFLC
TSTAAQLLYQLIHKIYAEESDLEIPVNTWESKFWTSIFEGFEAYPSSLFIGGNNGSDGAF
RLVIPYNSPAFHQTMASLLDYGDSFLDKLREHVSDNGSMSEQFNKYTGIMQGARDLTWSH
GALWSSSHFREQVLPLLSN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaaaggagaaaagatctaaagattctgattcaaagatgatcgagaagaaaagg
tcaaatagtaggggtttaggaaaattaccattgccactaccactaccattgatcgccttt
gttctgttcgtatgtgcaacttacaaatatattttaccacttaaggtggaaatggtaggt
tggccctcacaattttctccaccatttaacgaaacaaaccgtattatcattcaggatttt
ttcaagccatatgatccaagttatccgacatctttacctacaacaacttactacaggaga
attaatttacgcccattatcagctcacagaatttcaagagctaattttacgttatggctt
gaagaacaaacttcaatatcttttgaaaaaatattagaaaatattggtgattctgatatc
aatgatttataccaacaaaatgttgcagaaggtgctgttattgcctccccttcgaaggat
aagccagactatttctttcaatggcccagagatgctgctattactgtcaatactgtgatt
tctaatttaatgggatctgataatgccatcaacttgacactagcaaaaaccatcgtcaag
tatttaaataattccgctattctacagaggatacctaatccatccggtgaaggtgtaggt
ggaaccgatcctcagttgaaaggtcttggtgaaccaaaatttgaagtggataataaagca
tttgagggtaattgggggagacctcaaaatgatggtgcgccattaagattaattgctaca
ttccatttcttagaaaagttagctaaacaaaagattccattatcacaattattatccaat
ttgaagattgatggtctttcattccatgatgaagatagtctttttgagaatttaattcgt
tacgatttggaattcgttttgaataactggaaagtggattcattcgatctatgggaagaa
gttaaaggtcgtcatttcttcacaagtttagttcaactttctgctactaaattggggata
gattttatgaaatctaatccagatagacagaaggacccactactaaaggaattacaaagg
acctccacagagttaaacgactttttaacactagaaggtggatttctcaatcctcacaag
aactacattgtagaaacgccttctagtttgaatagtagatcaggattggatacagctgtt
ttaatagcatccttgttaactcatgccgatgatggtgaaacttctccgtataatctaccc
tttggtgttaacgattcaggaattttaaacactttacacgctttaaccagtattatggca
atcatataccctgttaaccaccaacgttatagtccacgtatgggtgtggctttaggtaga
tatcctgaagatgtttatgatggtgttaatacgtctgaaggtaatccatggtttttatgc
acttcaactgctgcacaattactctatcagttgattcacaaaatatatgctgaagaatca
gatttagaaattcctgtcaatacttgggaatccaaattttggacatctatatttgaaggt
tttgaagcatacccatcttctttatttataggtggtaataatggtagtgatggtgctttc
cgtttagtgattccatataattctccagcgtttcatcaaacgatggcttcgttgttagat
tacggtgattcatttttggataagctacgtgaacatgttagtgataacggatccatgagt
gaacagtttaacaaatatacagggatcatgcaaggtgctcgcgatttaacgtggtcacac
ggcgcattatggagtagttctcattttagagaacaggtactaccactactatccaattaa

DBGET integrated database retrieval system