KEGG   Zygosaccharomyces rouxii: ZYRO0D02970gHelp
Entry
ZYRO0D02970g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ZYRO0D02970g
Protein kinases [BR:zro01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   ZYRO0D02970g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(231363..233669)
Genome map
AA seq 768 aa AA seqDB search
MWNPLYLSSEDQEQLKKQQQQQGLQQRLHQMERRQSQSQRAQHQQHSQQHQQPQQQVQFT
FTNPWGNNEDLDPYYSSSAGASSTGLDTSETNPLLAAEYGGDGFDTYRRKSSLVIPPARA
PNPNPFEYDDRNAYAGVYDPQRQNQIRNMLLAQQQQQLAGARFVPSSFYGAGGDLHRRQS
VAAVHYPPSGPTNLASLGAPTNFTPAAGAATNMTPYRRLSCYPPSTSPTASLQPPYKQLR
RDAGAQGAMVGAPSPQQVKIPQMQKCNSKSELKPTLNATPKYRRASLNSKTISPVIALTK
GLITTYSLCSPDFSYQTSKNPKRVLTKPNEGKYNGGYDNINSDYILYVNDVLGTEQNRKY
LVLDILGQGTFGQVVKCQNILTKKIVAVKVVKSREEHLTQSITEARILDLLNTKVDPMNK
HHILQMYDTFVHKNHLCLVFELLSNNLYELLKQNQFHGLSMRLIRTFTAQLLDALCVLKD
SKLVHCDLKPENVLLCSPDRPDLKVIDFGSSCEERRTIYTYIQSRFYRAPEVLFGIPYST
SIDMWSLGCIVAELFLGIPILPGVSEFNQVSRIVECLGYPPVWMMDMGKNTSRFMKKDDT
LEEGLSFADGDDGRLGSPTMKYRLKTVDEYNQEYSSNEQPSKQYFKWTKMPDIIKNYRYS
KKIKGNPELIEQEQRDRDCLIHFLRGVLNINPLERWTPQLASMHPFVTQQPFTGEWYPPG
TLQSTATSNSTNDSTIPPGMNKNIGNIKHPSLQEGTAKEFDRLRIGED
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaccctctgtatctcagtagtgaggatcaggaacagttaaagaaacaacaacag
cagcagggtctgcaacaacgattgcatcagatggagagacgacagtctcaatcccaaaga
gcccagcatcagcagcattctcaacagcatcagcagccacaacaacaggtccagttcacg
tttaccaacccatggggcaacaatgaagatttagatccttattattcttcttcagctggt
gctagtagtacaggacttgatacctcagaaactaatccactgctggcagctgaatacggc
ggcgatggatttgacacatacagaaggaaatcaagtttggtaataccacctgcaagagcc
ccaaatcctaatccatttgaatacgacgataggaatgcatatgctggtgtatatgatcca
caacggcaaaatcagattcgtaatatgttgctggcccaacagcagcaacagttagcgggt
gcaagatttgttccatcttcattctatggtgccggtggagatttacacagaaggcaaagt
gtagctgctgttcattatccaccaagtgggcctacaaatttagcatcacttggggcgccc
actaactttacaccggcggctggcgcagctactaatatgacgccgtatcgtaggctaagt
tgttatccaccaagcacaagtcccactgcatctttacagcctccttacaagcaattgaga
agagatgctggtgctcaaggagctatggtgggagccccttctccacaacaagtcaagatt
ccgcaaatgcaaaaatgtaattctaaatcggagttaaaaccaactttaaacgcgactccg
aaatacagacgtgcatccttgaattctaaaactatttcaccagtaattgcattgactaag
ggattaattactacttattcattatgttctccagatttttcatatcaaacttccaaaaat
cccaagcgagtattgactaagcctaatgagggaaagtataacggcggttacgataacatc
aatagtgattacatcctatacgtgaatgacgtgttgggaactgaacagaacaggaaatat
ttggttttagacatcttgggtcagggtacttttggtcaagtggttaaatgtcagaacatc
ttgaccaaaaaaatcgttgcagttaaagtggttaagtctagagaagaacacctaactcaa
agtattacagaggcaaggattttagatttactcaacacaaaagtggatcccatgaataaa
catcacattctacaaatgtacgatacttttgttcacaagaatcatttatgccttgttttc
gagctattaagcaacaatctttatgagcttttgaaacaaaaccagttccacggtctttct
atgcgtctgattagaactttcacagctcagcttttagatgctctatgtgtgctcaaagac
agtaaattggttcactgtgatttgaaaccggaaaacgttttactgtgttcaccagatagg
cccgatttgaaagttattgattttggatcatcttgtgaagaaagaaggaccatttatacc
tatattcaatcgagattttatcgtgcacctgaagttttatttggtataccgtattccacc
agtattgatatgtggtcattagggtgtattgtagccgaactgtttttggggatccctatt
ttgccaggtgtatcggaatttaaccaagtgagtaggattgtagaatgccttgggtatcca
ccagtatggatgatggatatgggtaaaaatactagtaggtttatgaagaaagatgataca
ttagaagaaggattatcgtttgcagatggtgatgatggccgtctgggttcaccgactatg
aaatacagattaaagactgtggatgaatataatcaagagtattcctctaatgagcagcca
agcaagcaatactttaagtggacaaagatgccagatatcataaaaaattaccgctattcc
aaaaagataaaaggtaatccggagttgattgaacaagaacaaagggatagagattgtttg
atccatttcctaaggggtgtcttaaatatcaatcctttggaaagatggactccacagctg
gcatcaatgcatccgtttgtcacccaacaaccattcactggagaatggtatccaccaggc
acattacaatctactgctaccagcaatagtactaatgatagcactatccctccaggcatg
aataaaaatattggcaatataaagcatccgtcactacaagaaggtacggccaaggagttt
gatagacttagaataggtgaagactaa

DBGET integrated database retrieval system