KEGG   Zygosaccharomyces rouxii: ZYRO0D05258gHelp
Entry
ZYRO0D05258g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    ZYRO0D05258g
Enzymes [BR:zro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     ZYRO0D05258g
Glycosyltransferases [BR:zro01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   ZYRO0D05258g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(448819..451071)
Genome map
AA seq 750 aa AA seqDB search
MPSTTGFEGRIKGDNAELKNRKEVSSDEEEVLDEKEDYSKEKSTEQDPLVKIEAWIMPLV
FTALAFFIRMYKIGANNRVIWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGY
NGSYDFTSGEFYPEWVDFIKMRIFNAAFSALCVPLAYFTAKSIGFSLPTVWLFTCLVLFE
NSFTTLGKFILLDSMLLFFTVASFYCFVTYHSYRNQPFSRKWWKWISLTGITLGCTISVK
MVGLFIITVVGIYTVGELWTFLADKKMSWRTYFFHWFARIVCLILIPSAVFMLCFKVHFD
LLSHSGTGDANMPSLFQANLQGSGVGEGPRDVALGSSRVAIKNQALGGSLLHSHIQAFPE
GSNQQQVTCYGFKDANNLWQFDRPRGLPGYNENETDIEFITQDTEYRLVHISTGRNLHTH
PIPAPISRQAWEVSGYGNAEIGDVKDNWVIEVMDQRGPEDTSKIHPLTTSFRIKNAVLNC
YLAQTGQHLPEWGFRQSEVACVKDPFRRDKRTWWNVETHENELLPPRPEGFKFPKTNFFK
DFIHLNLAMMATNNALIPENDKLDYLTSAAWQWPSLNIGLRLCGWSDDNIRYFLLGTPIS
TWASTAAVGIFAVLFVLLVLRWQRQYNDLNKPGDFNLFLIGGVFPMLAWGTHFVPFLIMS
RVTYAHHYLPALYFALIVLSYIFDAGLKSWSVTKTNQVLRLAIYALFGISVIACFFYYGP
ISFGMEGAISDFQYLDWLPRWYISDKHKMP
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgccttccactactggttttgaaggtagaatcaagggagataatgccgaattgaagaac
aggaaggaggtttctagcgatgaagaagaagttttagatgagaaggaagattactcaaag
gaaaaatcaacagagcaagatccattggttaagatagaagcatggataatgccattggtt
tttacggcattggcatttttcattagaatgtacaagatcggtgctaacaaccgtgtgatt
tgggatgaagctcattttggtaagtttggatcttattatttgagacatgaattctatcac
gatgtgcatccaccattgggaaagatgctcgttggtctatctggttatctcgctggttac
aacggctcctatgactttacatctggtgagttttatcctgaatgggttgattttatcaag
atgagaattttcaacgctgccttctctgctctgtgtgttccattggcatattttaccgct
aaatccattggtttctctttaccaactgtttggttatttacgtgtttggttttgttcgaa
aattcttttacaacgttaggtaaatttatcctattggattctatgcttctattcttcaca
gtggcttcattttattgctttgtcacttaccatagttatagaaaccaaccattttccaga
aaatggtggaagtggattagtttgactggtattaccctcggatgtaccatttctgtcaag
atggtaggtcttttcatcattactgtggttggtatttacaccgtgggtgaattgtggaca
tttttggctgacaagaagatgtcttggaggacttactttttccattggtttgctagaatt
gtttgtttgatcttaataccatctgccgttttcatgctttgtttcaaagttcactttgat
cttttgagccattctggtactggtgatgctaacatgccatctttgttccaagccaatttg
caaggtagtggagtcggtgaaggtcctcgtgatgttgcattaggttcatcccgtgttgct
attaagaaccaagccttgggtggttctttgctacattcccacattcaagcttttccagag
ggttccaaccaacaacaagtcacttgctatggtttcaaagatgcaaacaatttgtggcaa
tttgatagacctagaggcttaccaggttacaacgaaaatgaaaccgatattgaattcatt
acacaggatacagaatacagattggtccatataagcaccggtagaaatttgcacactcat
cctattccagcacctatatctagacaagcttgggaagtttctggttatggtaatgctgaa
attggtgatgttaaggataactgggtcatcgaagtgatggaccaaagaggccctgaagat
acttctaagatccacccattgactacttccttccgtattaaaaacgctgtgttaaactgt
tatttggctcaaaccggtcaacatctaccggaatgggggttcagacaatcagaagttgct
tgtgtgaaagatccattcagaagagataagagaacttggtggaacgtcgaaactcatgaa
aacgaattactaccaccaagacccgagggcttcaaattcccaaagactaatttcttcaag
gactttattcacttgaatttggccatgatggctaccaacaacgctttaatcccagaaaat
gataaattggactatttgacttctgctgcatggcaatggccttccttgaatattggtcta
agactatgtggatggagtgatgataacattagatactttttgctaggtactccaatttct
acctgggcttcaactgccgctgtcgggatatttgccgttttgtttgtccttttggtcctg
agatggcaaagacaatacaacgatttgaacaagccaggtgatttcaatttattcttgatc
ggtggtgttttccccatgctagcctggggtacacatttcgtaccatttttgattatgtcc
agagttacttacgcgcaccactatctgccagcactatattttgcattaattgttttatcc
tacattttcgatgctggtttaaagagctggtccgtcactaagactaaccaagttttgaga
ttagccatttatgctctatttggcatctccgtcattgcatgcttcttttattatggacca
atttcatttggtatggaaggtgcaatctccgatttccaatacttggattggttaccgcgc
tggtacatctctgataagcacaaaatgccatga

DBGET integrated database retrieval system