KEGG   Zygosaccharomyces rouxii: ZYRO0D06182gHelp
Entry
ZYRO0D06182g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
zro  Zygosaccharomyces rouxii
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:zro04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(529121..530416)
Genome map
AA seq 431 aa AA seqDB search
MATHEEFIRTQVFGTVFEITNRYTDLNPVGMGAFGLVCSATDTLAGQPVAIKKIMKPFST
AVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDVEVDIWSAGCIFSEMIEGKPLFPGKDHVHQFSIITDLLGSPPRDV
INTICSENTLKFVTSLPHRDPVPFQERFKTVEPDAVDLLERMLVFDPKKRITAADALVHP
YLAPYHDPTDEPTAEAQFDWDFNDADLPVDTWRVMMYSEILDFHKIGGGDGQIDTNAAFD
DQVAAATAAAAHAAAMAQHHHQTQQQSSGKHTNPTTSSSAATHNSNGPHSNHDAIANYGN
QAVHYANEFQQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctacacatgaagaatttattaggacccaagtgtttgggacggttttcgaaattacc
aacaggtacacggatctaaatcctgttggtatgggggcatttggtctggtatgctcagca
acagataccttggcggggcaaccagtagctatcaaaaaaataatgaaaccattctctacc
gcagtattggctaaacgtacttacagagagctgaaattattaaaacatttaagacatgaa
aatttgatttgcttacaagatatcttcttatctccactcgaagatatctatttcgttaca
gaattacaaggtacagatttgcatcgtcttctacaaacgagaccattggaaaaacaattt
gttcaatattttctgtaccaaattcttagaggattaaagtatgtgcattcggcaggtgta
attcatagggatctcaaacctagtaacatacttataaacgagaactgcgatctaaagata
tgtgatttcggattagctagaattcaggatcctcaaatgacagggtacgtttcgactagg
tactatagagcacctgagattatgttaacgtggcaaaagtatgatgttgaagttgatatt
tggtccgcgggttgtattttttcggaaatgatagagggtaaaccattattccctggtaaa
gatcacgtccatcaattttcgattattacagatttattgggctcacctccaagggatgtt
ataaataccatatgttcggagaatactttgaaatttgttacgtctttgccacacagagat
ccagttccattccaagaaaggttcaagactgtggaacccgatgcagtagatctattagaa
cgtatgttagtattcgatcctaagaagaggattacagcagctgatgcattagtacatcca
tatttagcaccttatcacgatccaactgatgaaccaactgccgaagcccagttcgattgg
gatttcaatgatgcagatctgcctgttgatacttggcgtgtaatgatgtattcagaaatt
ctagatttccataaaattggtggtggtgatggtcaaattgatacgaatgcggcattcgat
gatcaagttgcagctgctactgctgcagctgctcatgctgcagctatggctcaacaccat
catcaaactcaacaacaatcatccggcaaacatacaaatccaactacttcatcatcggcc
gctacgcataacagtaacggtccccatagcaatcacgatgccatcgctaattatggtaat
caagcggttcactacgctaatgaattccaacagtag

DBGET integrated database retrieval system