KEGG   Zygosaccharomyces rouxii: ZYRO0D07480gHelp
Entry
ZYRO0D07480g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZYRO0D07480g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ZYRO0D07480g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:651778..652509
Genome map
AA seq 243 aa AA seqDB search
MHNPRHIESLQRRGTPLNTRPASPYTLNPPVEADGFSWPSVGTRIRADENEEQESKRVDR
ISGAVKTILEELGEDVTREGLADTPQRYAKAMLFFTKGYQTNIMDDVIKNAVFEEDHDEM
VIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKRVLGLSKLARLAEMYCRRLQVQERLTKQI
AMALGDILKPMGVAVVIEATHMCMVSRGIQKSGSATVTSCMLGCFRAHRTREEFLSLLNK
RTI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcacaatcctcggcacattgagtcattgcaaagaaggggtacccccttgaacaccagg
ccagcatccccctatactttaaatccaccagtagaagctgatgggttctcgtggccaagt
gtaggtactcgaattagagctgatgaaaatgaagaacaagagagcaaacgtgtagatcgt
atctctggtgccgttaagacaattctagaggaattgggtgaagatgtaactcgagaaggt
ttggcagatacaccacagagatatgcaaaggcaatgcttttcttcaccaaaggttaccaa
acaaatatcatggatgatgtcattaaaaatgctgtttttgaagaggatcatgacgaaatg
gtaattgtgcgtgatattgaaatttattcattgtgtgagcaccatttagtgccatttttc
ggtaaagtgcatattggttacattccaaataaaagagtcctcggattgagtaaattggca
aggttagcggaaatgtactgtagacgtttgcaagtacaagaaagattgacaaagcagatt
gcaatggcgttgggtgatattttgaagccgatgggggttgctgttgttattgaagcaact
cacatgtgtatggtatcgagaggaatccaaaagagtggatctgccactgtcacctcgtgt
atgttgggttgctttagagctcatagaactagagaagagttcttgagtcttctaaacaaa
agaacgatatga

DBGET integrated database retrieval system