KEGG   Zygosaccharomyces rouxii: ZYRO0D07744gHelp
Entry
ZYRO0D07744g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K07204  regulatory associated protein of mTOR
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro04136  Autophagy - other
zro04138  Autophagy - yeast
zro04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:zro00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    ZYRO0D07744g
   04136 Autophagy - other eukaryotes
    ZYRO0D07744g
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    ZYRO0D07744g
Membrane trafficking [BR:zro04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    ZYRO0D07744g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Raptor_N HEAT WD40 Cnd1 HEAT_2
Motif
Other DBs
NCBI-GeneID: 8204025
NCBI-ProteinID: XP_002496771
UniProt: C5DVL9
Position
D:674077..678654
Genome map
AA seq 1525 aa AA seqDB search
MPVTYGPQPLRPINVDTRHGFGEQYHSEQFLQSLANDFIFYFDDKRHKTNGNPTPEEEKE
EDAQHYYQPIQDWKIMKDRQKTVSAALLLCLNLGVDPPDVIKTQPCARVESWVDPLNFQD
SKKAIEQIGKNLQTQYETLSLRTRYKQSLDPCVGDVKRFCNSLRRTSKDDRILFHYNGHG
VPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNNAGNIVNNFKKFVQKRI
REEQEGIQNTSAPSPSFTNAECFQLASCRSDELLLMSPELPADLFTCCLTCPIEISVRVF
LMQTPLKESKYKILFENPITSEFDDDKNSYKSRIPNVNIPGVLSDRRTPLGELNWIFTAI
TDTIAWTSLPRPLFKKLFRHDLMVAALFRNFLLAKRIMPWYNCHPISDPELTDSIASHPM
WQAWDLALDEVLSKLVEDLKNAPPSTDLESQLILQQQESLQSQTPQRNEIKSDTIQAHSR
FAVGNLSTMSLANHPAAQSATRKSAASLVQVPQQQQQKQFTGFFEQNLTAFELWLKYASN
TRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAP
ELKPILVFIWSRIMSIDYKNTQAELIKEKGFMYFVSVLVPDWGVLPSPASSSSIAPGSQF
SMAASPSLNGSRGQFYPSQGGAYLATHYHSNDTTDEQKAMAVFVLSSFVRDFPLGQRYCF
SLDLVDKLSFYLENSEIPLLRQWCAILIGQLCSHNSLYRHICMNAGIINTLLGSLKDPVP
EVRTAVLLALKNFISDVDDVDQMFRMQQEMEQQYHQLHAQLQQLRGGSHQQQAHHIEQQQ
IKLEQQIQHCQIMQLQMQNIEPRKLKRQEVTNLVAVLGLINDGSPLVRKEVIIFLSQVVY
RYINFFIVVAFNELIEEIIQMEGKDSDAQNFSDKYSVSHGSVFSTVWEALLILAEDPYSE
NRSLAGQVVDYILLELSTHKDLSDAFSKIEHYLAKRSVGQNGRSMVSNPQVQLLKKPNLP
FSSDKNGKNESTERKKDGSSIRKKGASLSKFFQNLSLGTSRSGSENDLRGMVNDHDSKPA
GLSFLSVPHGMAPQATIPRPRKFDGALKLPLESTFLDYSREYFQEPQMRRHETDEPGSVE
YSARVWRRNRNESIIQETQAEKKLALYGDWSNRVVTLDNKTQPKLLRFAQFENHLVSVDE
RDEVTVFDWDSKRTLSRFSNGNPFGTKVTDLKFLNEDDAALLLAGSSDGIVKIYKNIHSN
DDLELISAWRGLTDMLLTPRSSGLLTEWQQIRGSLLTTGDVKIIRAWDAHTETVEVDIPA
KTSSLITSITSDQLAGNLVVAGFADGSLRVYDRRVDPRDSMVRLWGPGAGSRRTWINNVH
MQRGGCRELVSGATNGVVELWDIRMNEPVGMFTDENVQQQNGQRRTTTMTTTQVHEHAPI
IATGTKQVKIWTTSGDLLSSFKNQHNTGGVAGTLAVTGIRSTLSSSSAFLSSMAFHPHRM
MLAAANSHDTGISIYKCEDRNSEFY
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atgccggttacctatggacctcagccattgaggcctataaatgtggatactagacatgga
tttggtgaacagtaccacagtgaacagtttttacagtcattagccaacgatttcatattt
tattttgatgataagagacataagactaacggtaatccgactcctgaggaggaaaaggag
gaggatgcacagcattactaccagcctatacaggattggaagattatgaaagatagacaa
aaaaccgttagtgcagctttattgttgtgtctgaatttgggagtagatccaccggatgtt
atcaaaacgcagccatgtgcaagggtagagtcatgggtagatccattgaatttccaggac
tctaagaaggcaattgagcaaattggtaaaaatttgcagacccaatatgagactttatcg
ctacgaactcgatacaagcaaagtttagatccatgtgttggagacgtgaagaggttttgc
aattcgttgagaagaacctccaaggatgatcggatattgttccactacaatggacatgga
gttccacaaccaacaccgtcaggtgaaatatgggtttttaacagaggttatacgcaatat
atccccgtgtctctatatgatttacaaacttggttgggggcaccatgcatatttgtttat
gattgtaacaatgctggaaacattgtaaacaattttaagaaatttgttcaaaagagaatc
agagaagagcaagaaggtatccaaaatacatcagcaccgtcgccatcatttaccaatgca
gagtgttttcagcttgcatcgtgcagatctgacgaattgttactcatgtcacctgaacta
ccggcagatctattcacatgttgtttgacatgtcccattgaaattagtgtgagagtgttt
ctaatgcaaacaccgttaaaagaatctaagtataagattctatttgaaaatccaattaca
agtgaatttgacgacgataaaaactcttataaatctaggattcccaatgttaacattcca
ggtgttttgtccgatagaagaacaccgttaggtgaattaaattggatctttacagcgatt
accgatactatagcttggacttccttacctcgtccactgttcaagaaattattcagacat
gaccttatggtagcagcattgttccgtaatttcttgttagctaaaagaattatgccgtgg
tacaattgccaccctatttcagatccagaattaacggatagcatagctagccatccaatg
tggcaagcgtgggatttagccttagatgaggtgttgagcaaactggtggaagatttaaaa
aatgcgccgccttctactgacttggagagtcaattaattttacaacaacaagagtcttta
caaagccaaacaccgcaaagaaatgagattaaatcagataccatccaagcacattcgagg
tttgcagtcgggaatttgagtaccatgtcattggctaatcatccagcggcacaatcagca
accaggaaatcagcggcaagtttggtgcaagtgccacagcaacagcaacaaaaacaattc
accggtttctttgaacaaaacctgactgccttcgaactatggttgaaatatgcatccaat
acaagacatccaccggagcaactaccgattgtattgcaagtgttattgtcccaagttcat
cggatacgtgcattggtactcctctcccgattcctcgatttgggaccatgggcggtctat
ttatcgctgtctatagggatttttccctacgttctgaaacttctgcaaagtcccgcacct
gaattgaagcccattttggttttcatttggtcgaggatcatgtcgattgattataagaac
acacaggctgagcttattaaggaaaaagggttcatgtacttcgtgtcagtattagtaccc
gattggggcgtgcttccatcaccagcaagtagttcttccattgcgccaggctcacaattt
tccatggctgctagtcctagcttaaatggttctagaggtcaattttatccttcccagggg
ggcgcttacctagctactcattatcactctaatgatacaactgatgagcagaaggcaatg
gcggtttttgtcctttcttcgttcgtgagagatttcccactgggtcagaggtattgtttc
agcttagacttggtggacaaattaagcttctacttggaaaattctgaaattcccctgcta
cgacaatggtgtgcaattttaattggccaactttgcagtcacaattcgctttacaggcat
atatgtatgaatgcgggcatcataaacacattgctgggatctttgaaagatcctgttccc
gaagtgagaaccgctgtgctattggctttgaagaatttcatttctgatgtcgatgatgtt
gaccagatgttcagaatgcagcaagaaatggaacaacaatatcaccaacttcatgcacag
ctgcaacaattgcggggcggttcacatcagcagcaggcacatcatattgaacaacagcag
attaaattggagcaacagattcagcattgtcaaatcatgcaattgcagatgcaaaatatt
gaaccaaggaaattgaaaagacaggaggtcaccaaccttgtagcagttttagggttaata
aatgatggatcgccattggtaagaaaggaagtgatcatttttttatcacaagttgtttac
cgttacattaatttcttcatcgtcgtggcatttaatgaattgatcgaagagattattcaa
atggaaggcaaagattctgatgctcagaacttttctgataaatactcggttagtcatgga
tctgtttttagtactgtttgggaagcgctactgattctggctgaggatccttattctgaa
aaccgctctttggccggacaagttgttgattatattttgctagagctaagtacccacaag
gacctaagtgatgcattctcaaagattgagcactatttggctaaaagaagcgtgggccaa
aatggtaggtcaatggtaagtaaccctcaagttcagcttttgaaaaagccaaatttacca
ttctcttcagataagaatggaaagaatgaaagtactgaaagaaagaaggatggtagcagc
atacgtaagaaaggtgcatctttaagcaagttcttccagaaccttagtttgggaacttcg
agaagtggatctgaaaatgacttgcgtggaatggtgaatgatcatgattcgaaacctgcc
ggattatctttcttgagtgtgccacatggtatggcgcctcaagcaacgatcccaagacct
cggaagtttgatggagcattgaaactgccattggaaagcactttcttggactattctcgt
gaatattttcaagaaccacagatgagaagacatgaaactgatgagccaggaagtgttgaa
tatagtgctagagtatggcgcagaaacagaaatgagagtattattcaagagactcaagct
gaaaagaaattggcgctttacggcgattggtctaatcgtgtggtcaccttggataataag
acgcaaccgaaattgttgaggtttgcacaatttgaaaatcacttggttagcgtagatgaa
agagacgaagtgacagttttcgattgggattccaagagaacgttatcaagattttccaat
ggcaatccatttggtactaaagttacggatctaaaatttttaaatgaagatgatgctgcc
ctactgttggctggttcatccgatggtatcgtgaagatctataagaatattcattctaat
gatgatctcgagcttatttctgcatggagaggtttgactgatatgttgttgactcctcgt
tctagcggactattaactgaatggcaacagattagaggttcccttttaactactggtgat
gtaaaaatcattcgtgcatgggatgcccatacggaaacggttgaagtggatatacctgcg
aagacttcatccttaattacatctattacatcggaccaattggcaggtaatcttgttgtt
gccggttttgccgatgggtccctcagagtatacgatagacgtgtcgacccaagagattct
atggttagactctggggaccaggtgcaggttccagacgtacatggatcaataacgttcac
atgcaaagaggtggttgcagagaattggttagtggtgctactaatggtgttgtagagtta
tgggatatacgaatgaatgagcctgtaggtatgttcactgatgaaaacgttcaacaacag
aatggacaaagaagaactactaccatgactaccactcaagtacatgaacatgctccaatt
attgctacaggaacgaaacaggtcaaaatttggactacatctggtgatcttttgtccagt
ttcaaaaaccaacacaacactggtggtgtggcaggtactctagctgtcacaggtatcaga
tccacattatcgtcttcaagcgcatttttgtcatcgatggcattccatcctcatagaatg
atgttggctgctgccaattctcatgatactggcatcagtatctataaatgtgaggacagg
aactctgagttttactaa

DBGET integrated database retrieval system