KEGG   Zygosaccharomyces rouxii: ZYRO0D07744gHelp
Entry
ZYRO0D07744g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
zro  Zygosaccharomyces rouxii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:674077..678654
Genome map
AA seq 1525 aa AA seqDB search
MPVTYGPQPLRPINVDTRHGFGEQYHSEQFLQSLANDFIFYFDDKRHKTNGNPTPEEEKE
EDAQHYYQPIQDWKIMKDRQKTVSAALLLCLNLGVDPPDVIKTQPCARVESWVDPLNFQD
SKKAIEQIGKNLQTQYETLSLRTRYKQSLDPCVGDVKRFCNSLRRTSKDDRILFHYNGHG
VPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNNAGNIVNNFKKFVQKRI
REEQEGIQNTSAPSPSFTNAECFQLASCRSDELLLMSPELPADLFTCCLTCPIEISVRVF
LMQTPLKESKYKILFENPITSEFDDDKNSYKSRIPNVNIPGVLSDRRTPLGELNWIFTAI
TDTIAWTSLPRPLFKKLFRHDLMVAALFRNFLLAKRIMPWYNCHPISDPELTDSIASHPM
WQAWDLALDEVLSKLVEDLKNAPPSTDLESQLILQQQESLQSQTPQRNEIKSDTIQAHSR
FAVGNLSTMSLANHPAAQSATRKSAASLVQVPQQQQQKQFTGFFEQNLTAFELWLKYASN
TRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAP
ELKPILVFIWSRIMSIDYKNTQAELIKEKGFMYFVSVLVPDWGVLPSPASSSSIAPGSQF
SMAASPSLNGSRGQFYPSQGGAYLATHYHSNDTTDEQKAMAVFVLSSFVRDFPLGQRYCF
SLDLVDKLSFYLENSEIPLLRQWCAILIGQLCSHNSLYRHICMNAGIINTLLGSLKDPVP
EVRTAVLLALKNFISDVDDVDQMFRMQQEMEQQYHQLHAQLQQLRGGSHQQQAHHIEQQQ
IKLEQQIQHCQIMQLQMQNIEPRKLKRQEVTNLVAVLGLINDGSPLVRKEVIIFLSQVVY
RYINFFIVVAFNELIEEIIQMEGKDSDAQNFSDKYSVSHGSVFSTVWEALLILAEDPYSE
NRSLAGQVVDYILLELSTHKDLSDAFSKIEHYLAKRSVGQNGRSMVSNPQVQLLKKPNLP
FSSDKNGKNESTERKKDGSSIRKKGASLSKFFQNLSLGTSRSGSENDLRGMVNDHDSKPA
GLSFLSVPHGMAPQATIPRPRKFDGALKLPLESTFLDYSREYFQEPQMRRHETDEPGSVE
YSARVWRRNRNESIIQETQAEKKLALYGDWSNRVVTLDNKTQPKLLRFAQFENHLVSVDE
RDEVTVFDWDSKRTLSRFSNGNPFGTKVTDLKFLNEDDAALLLAGSSDGIVKIYKNIHSN
DDLELISAWRGLTDMLLTPRSSGLLTEWQQIRGSLLTTGDVKIIRAWDAHTETVEVDIPA
KTSSLITSITSDQLAGNLVVAGFADGSLRVYDRRVDPRDSMVRLWGPGAGSRRTWINNVH
MQRGGCRELVSGATNGVVELWDIRMNEPVGMFTDENVQQQNGQRRTTTMTTTQVHEHAPI
IATGTKQVKIWTTSGDLLSSFKNQHNTGGVAGTLAVTGIRSTLSSSSAFLSSMAFHPHRM
MLAAANSHDTGISIYKCEDRNSEFY
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atgccggttacctatggacctcagccattgaggcctataaatgtggatactagacatgga
tttggtgaacagtaccacagtgaacagtttttacagtcattagccaacgatttcatattt
tattttgatgataagagacataagactaacggtaatccgactcctgaggaggaaaaggag
gaggatgcacagcattactaccagcctatacaggattggaagattatgaaagatagacaa
aaaaccgttagtgcagctttattgttgtgtctgaatttgggagtagatccaccggatgtt
atcaaaacgcagccatgtgcaagggtagagtcatgggtagatccattgaatttccaggac
tctaagaaggcaattgagcaaattggtaaaaatttgcagacccaatatgagactttatcg
ctacgaactcgatacaagcaaagtttagatccatgtgttggagacgtgaagaggttttgc
aattcgttgagaagaacctccaaggatgatcggatattgttccactacaatggacatgga
gttccacaaccaacaccgtcaggtgaaatatgggtttttaacagaggttatacgcaatat
atccccgtgtctctatatgatttacaaacttggttgggggcaccatgcatatttgtttat
gattgtaacaatgctggaaacattgtaaacaattttaagaaatttgttcaaaagagaatc
agagaagagcaagaaggtatccaaaatacatcagcaccgtcgccatcatttaccaatgca
gagtgttttcagcttgcatcgtgcagatctgacgaattgttactcatgtcacctgaacta
ccggcagatctattcacatgttgtttgacatgtcccattgaaattagtgtgagagtgttt
ctaatgcaaacaccgttaaaagaatctaagtataagattctatttgaaaatccaattaca
agtgaatttgacgacgataaaaactcttataaatctaggattcccaatgttaacattcca
ggtgttttgtccgatagaagaacaccgttaggtgaattaaattggatctttacagcgatt
accgatactatagcttggacttccttacctcgtccactgttcaagaaattattcagacat
gaccttatggtagcagcattgttccgtaatttcttgttagctaaaagaattatgccgtgg
tacaattgccaccctatttcagatccagaattaacggatagcatagctagccatccaatg
tggcaagcgtgggatttagccttagatgaggtgttgagcaaactggtggaagatttaaaa
aatgcgccgccttctactgacttggagagtcaattaattttacaacaacaagagtcttta
caaagccaaacaccgcaaagaaatgagattaaatcagataccatccaagcacattcgagg
tttgcagtcgggaatttgagtaccatgtcattggctaatcatccagcggcacaatcagca
accaggaaatcagcggcaagtttggtgcaagtgccacagcaacagcaacaaaaacaattc
accggtttctttgaacaaaacctgactgccttcgaactatggttgaaatatgcatccaat
acaagacatccaccggagcaactaccgattgtattgcaagtgttattgtcccaagttcat
cggatacgtgcattggtactcctctcccgattcctcgatttgggaccatgggcggtctat
ttatcgctgtctatagggatttttccctacgttctgaaacttctgcaaagtcccgcacct
gaattgaagcccattttggttttcatttggtcgaggatcatgtcgattgattataagaac
acacaggctgagcttattaaggaaaaagggttcatgtacttcgtgtcagtattagtaccc
gattggggcgtgcttccatcaccagcaagtagttcttccattgcgccaggctcacaattt
tccatggctgctagtcctagcttaaatggttctagaggtcaattttatccttcccagggg
ggcgcttacctagctactcattatcactctaatgatacaactgatgagcagaaggcaatg
gcggtttttgtcctttcttcgttcgtgagagatttcccactgggtcagaggtattgtttc
agcttagacttggtggacaaattaagcttctacttggaaaattctgaaattcccctgcta
cgacaatggtgtgcaattttaattggccaactttgcagtcacaattcgctttacaggcat
atatgtatgaatgcgggcatcataaacacattgctgggatctttgaaagatcctgttccc
gaagtgagaaccgctgtgctattggctttgaagaatttcatttctgatgtcgatgatgtt
gaccagatgttcagaatgcagcaagaaatggaacaacaatatcaccaacttcatgcacag
ctgcaacaattgcggggcggttcacatcagcagcaggcacatcatattgaacaacagcag
attaaattggagcaacagattcagcattgtcaaatcatgcaattgcagatgcaaaatatt
gaaccaaggaaattgaaaagacaggaggtcaccaaccttgtagcagttttagggttaata
aatgatggatcgccattggtaagaaaggaagtgatcatttttttatcacaagttgtttac
cgttacattaatttcttcatcgtcgtggcatttaatgaattgatcgaagagattattcaa
atggaaggcaaagattctgatgctcagaacttttctgataaatactcggttagtcatgga
tctgtttttagtactgtttgggaagcgctactgattctggctgaggatccttattctgaa
aaccgctctttggccggacaagttgttgattatattttgctagagctaagtacccacaag
gacctaagtgatgcattctcaaagattgagcactatttggctaaaagaagcgtgggccaa
aatggtaggtcaatggtaagtaaccctcaagttcagcttttgaaaaagccaaatttacca
ttctcttcagataagaatggaaagaatgaaagtactgaaagaaagaaggatggtagcagc
atacgtaagaaaggtgcatctttaagcaagttcttccagaaccttagtttgggaacttcg
agaagtggatctgaaaatgacttgcgtggaatggtgaatgatcatgattcgaaacctgcc
ggattatctttcttgagtgtgccacatggtatggcgcctcaagcaacgatcccaagacct
cggaagtttgatggagcattgaaactgccattggaaagcactttcttggactattctcgt
gaatattttcaagaaccacagatgagaagacatgaaactgatgagccaggaagtgttgaa
tatagtgctagagtatggcgcagaaacagaaatgagagtattattcaagagactcaagct
gaaaagaaattggcgctttacggcgattggtctaatcgtgtggtcaccttggataataag
acgcaaccgaaattgttgaggtttgcacaatttgaaaatcacttggttagcgtagatgaa
agagacgaagtgacagttttcgattgggattccaagagaacgttatcaagattttccaat
ggcaatccatttggtactaaagttacggatctaaaatttttaaatgaagatgatgctgcc
ctactgttggctggttcatccgatggtatcgtgaagatctataagaatattcattctaat
gatgatctcgagcttatttctgcatggagaggtttgactgatatgttgttgactcctcgt
tctagcggactattaactgaatggcaacagattagaggttcccttttaactactggtgat
gtaaaaatcattcgtgcatgggatgcccatacggaaacggttgaagtggatatacctgcg
aagacttcatccttaattacatctattacatcggaccaattggcaggtaatcttgttgtt
gccggttttgccgatgggtccctcagagtatacgatagacgtgtcgacccaagagattct
atggttagactctggggaccaggtgcaggttccagacgtacatggatcaataacgttcac
atgcaaagaggtggttgcagagaattggttagtggtgctactaatggtgttgtagagtta
tgggatatacgaatgaatgagcctgtaggtatgttcactgatgaaaacgttcaacaacag
aatggacaaagaagaactactaccatgactaccactcaagtacatgaacatgctccaatt
attgctacaggaacgaaacaggtcaaaatttggactacatctggtgatcttttgtccagt
ttcaaaaaccaacacaacactggtggtgtggcaggtactctagctgtcacaggtatcaga
tccacattatcgtcttcaagcgcatttttgtcatcgatggcattccatcctcatagaatg
atgttggctgctgccaattctcatgatactggcatcagtatctataaatgtgaggacagg
aactctgagttttactaa

DBGET integrated database retrieval system