KEGG   Zygosaccharomyces rouxii: ZYRO0D08052gHelp
Entry
ZYRO0D08052g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     ZYRO0D08052g
Protein kinases [BR:zro01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   ZYRO0D08052g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(698913..700409)
Genome map
AA seq 498 aa AA seqDB search
MTKIKFNSGLLKQIWNYSELPQTGISLRQMCQFGANPNPATLFKASCFVLRELPIRLAHR
IKELESLPNGLNKMNDVIQVRDWYTQSFKELYEFAHDRSTSNGKLYQMLYGGLEPDTPME
SEVLRNIIQLCYRDEELDSKHGRSNTSVPHRNTFVDDGLVVTKRKWSVSNQSLSSSRGQV
LTPKKYYSSPLVTSLEVWPKEILKFNAALFKVLHNIKVRHNATVVTLAKGVLKWKKTCQQ
NMFDDSVQSFLDRFYMSRIGIRMLIAQHLDLLEPSLHCQNGKSDSYVGSICTKTNITQIA
EDAIDNAKLICSEHYGLFEAPEVELLCFPKNATGLNNEIEFMYVPGHLIHMLVETLKNAL
RATVEKTVESNPGMDVYDLKFPHVKVIICEGLEDITVKISDEGGGIARSNLPLIWTYLYS
TMPDDCQLELMKDECDENPRVSSFVNNVPLAGYGYGLALSRLYARYFGGDLKLISMEGFG
TDVYLHLNRLSTSSEPLQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatcaagtttaatagtggactgttgaagcagatatggaattactctgaactc
ccccagactggtatttccttgagacaaatgtgccagtttggagctaatcctaatcctgcc
acattgtttaaagcatcgtgttttgttctaagggaattgcctatccgattggcccatagg
attaaagaattagaaagcctgcccaatggcctcaataaaatgaatgatgtgattcaggtc
cgtgactggtacactcaatcgtttaaggaactgtacgaatttgctcatgacaggtcgact
agtaacggtaaattgtaccagatgctctatggcggacttgaacctgatacaccaatggaa
agtgaagttttacgaaacatcattcagttgtgttatagggatgaagaattggattctaag
catggacgttccaatacttcggttccccataggaacacttttgttgatgatgggcttgtg
gtaacaaaaaggaaatggagtgtatccaatcaatcattaagtagcagtaggggtcaagtt
ttgacaccgaagaaatactactcatcgccgcttgttacctcgttggaagtttggccaaaa
gaaattttgaaattcaatgctgcattgtttaaagtattacacaacattaaagttaggcac
aacgctacggttgtgacattggctaaaggagtcttaaaatggaaaaaaacttgtcaacag
aatatgttcgatgattcagtacaaagctttttggacaggttctatatgagccgtattgga
attcgtatgctcattgcgcaacatttggacctgttagaaccttccctgcattgccaaaat
ggcaaaagtgacagctatgtggggagcatttgtactaaaacgaacattacacagatcgct
gaagacgctattgataatgctaaattgatctgctctgaacactacggcttgtttgaagca
ccagaagtggaactgctgtgtttcccaaaaaatgctactggcctcaacaacgaaatcgaa
ttcatgtacgtaccaggacatttgatacacatgctggtggaaactttaaagaatgccctc
agggctaccgttgaaaaaactgttgaatcgaatcctgggatggatgtttacgatttaaag
ttcccccatgtcaaggtaatcatatgtgaagggttggaagacattactgtgaaaatctcc
gatgaaggcggtggaatcgcaagatcgaatttaccgctgatatggacttacttgtactcc
acgatgccagatgattgtcaattggaattaatgaaggatgaatgcgatgagaatccccga
gtatcgtcctttgtcaataacgtacccttagctggctatgggtatggactagcactcagt
agattatatgcaaggtattttggcggcgacttgaaacttatatccatggaaggattcggc
actgatgtttatctgcatttgaatcggttgagtactagtagtgaaccattgcaataa

DBGET integrated database retrieval system