KEGG   Zygosaccharomyces rouxii: ZYRO0D08602gHelp
Entry
ZYRO0D08602g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00260  Glycine, serine and threonine metabolism
zro00750  Vitamin B6 metabolism
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
zro01230  Biosynthesis of amino acids
Module
zro_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZYRO0D08602g
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ZYRO0D08602g
Enzymes [BR:zro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ZYRO0D08602g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 8204064
NCBI-ProteinID: XP_002496807
UniProt: C5DVQ5 B2G4S4
Position
D:complement(741538..743079)
Genome map
AA seq 513 aa AA seqDB search
MVSPSQVYRSTRSSDKQTYSFEDVVIQGLASDGGLFVPPEIPQVSQDVLFGKWAKLSFQD
LQFEIMRLYIPQDEIPDADLKDLITRSYSTFRSSDVTPVAKNITGDKENLHVLELFHGPT
YAFKDVALQFLGNLFEYFLERTNKDLPSEQRKKITVVGATSGDTGSASIYGLRGKKDVSV
FILYPTGRISPLQEEQMTVVPDKNVQTLSVQGTFDKCQDIVKAIFGDKEFNSRHNVGAVN
SINWARILSQMTYYFYAYFQATGGKAEKLKFVVPSGNFGDMLAGYFAKKMGLPVEKLVIA
TNENDILDRFLKSGVYERSDEVASTHSPAMDILVSSNFERLLWYLALEYLADGDSLKAGQ
IVNDWFQQLKTEGKFQVEKVIVEGALKDFASDRVSNEETLATIKKVYEVSQNPQHYILDP
HTAVGVTAAERLIAADKDNSIHYVSLSTAHPAKFAEAVNQALSSFGTYSFERDVLPDELR
KLSTMEKKIKLVDRADLKLIESIIDEESAKMGL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggtttccccttctcaagtttacagatccaccaggtcctctgataagcagacttattcc
ttcgaagatgttgtgatccaaggtttggctagtgatggtggtttattcgtccccccagaa
attccacaggtgtctcaagacgttttgtttggtaaatgggctaagctctcattccaagat
ttgcaatttgaaatcatgagactttacattcctcaggatgaaatcccagatgctgacttg
aaagatctaattacaagatcatactctaccttccgttcatctgatgtgactccagtagct
aagaatattaccggtgacaaagagaatctacatgttttagaattattccatggtccaacc
tacgctttcaaagatgtggcattacaatttctaggtaatttgttcgaatatttcttagag
agaaccaacaaggatctaccttcagagcaaagaaagaagatcacagtggtaggtgctacc
tctggtgatactggttcagcttctatctatggtctaagaggtaagaaggatgtttctgtc
ttcatcttatatccaactggtagaatttctccattgcaagaagaacagatgactgtcgtg
ccagataagaacgtgcaaactttgtctgtgcaaggtacttttgacaaatgtcaagacatc
gtgaaggctatcttcggtgacaaagaattcaacagtagacacaacgttggtgctgtgaat
tccatcaactgggcaagaattttgtcccaaatgacttactacttctacgcttatttccaa
gctactggtggtaaggctgaaaaattgaagtttgttgtgcccagcggtaactttggtgat
atgttggccggttatttcgctaagaagatgggattgccagtggaaaaattggttattgcc
acaaatgaaaatgacatcttggacagatttttgaagtctggtgtctatgaaaggtctgac
gaagtggcttccacccactccccagccatggacattctggtgtcttccaacttcgaaaga
ttactgtggtacttggctctagaatatttggcagacggtgactctttgaaggctggtcaa
attgtcaacgactggttccaacaactaaagaccgagggtaaattccaagtggaaaaggtc
atcgtggaaggtgcattgaaggattttgcttccgacagggtttccaatgaagagactctt
gccaccatcaagaaggtttacgaggtttctcaaaaccctcagcattatatcttggatcct
cataccgctgttggtgttactgccgctgaaagattgatcgctgcagacaaggacaactcc
attcactacgtttctttgtctaccgctcacccagcaaaatttgcagaagctgttaatcaa
gcattgtcctctttcggtacttactcttttgaaagagatgttctacctgatgagttgaga
aagctttctacaatggaaaagaagatcaagttggtcgacagagctgatctgaaattgata
gaatccatcattgacgaggaaagtgcaaagatgggattgtaa

DBGET integrated database retrieval system