KEGG   Zygosaccharomyces rouxii: ZYRO0D08910gHelp
Entry
ZYRO0D08910g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ZYRO0D08910g
   00640 Propanoate metabolism
    ZYRO0D08910g
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ZYRO0D08910g
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    ZYRO0D08910g
Enzymes [BR:zro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ZYRO0D08910g
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ZYRO0D08910g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
D:758822..765862
Genome map
AA seq 2346 aa AA seqDB search
MYFFGSIDLRPAVSFARSACLFVCLSTFFFSFVFVFSLFDNPTTFPISIQQYYTREKNKN
KKNQTTKRLDSDCSGSNTNIKTISSLFRQIRFNFVSSLPRLRLTRCFHFNRTQLKMSEES
LFEVSSKVGVEEIADYAKEHAKLPASFIGYRTVDKAEESPLKDFVRNHGGHTVISKILIA
NNGIAAVKEIRSVRKWAYETFGDDRAVQFVAMATPEDLEANAEYIRMAEQYVEVPGGTNN
NNYANVDLIVEIAERADVDAVWAGWGHASENPDLPETLANSKRKILFIGPPGNAMRSLGD
KISSTIVAQHAKVPCIPWSGTGVDKVRIDYESGLVCVDDEIYKQGCSTSAEDGLERAKKI
GFPVMVKASEGGGGKGIRQVHRAEDFIPLYNQAANEIPGSPIFIMKLAGRARHLEVQLLA
DQYGANVSLFGRDCSVQRRHQKIIEEAPVTIAKPDTFKEMEKAAVRLGKLVGYVSAGTVE
YLYSHDDDQFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRIRDIRMLYGMH
PQQSTKIDFEFANEESSTTQRKPTPKGHCTACRITSEDPNEGFKPSGGSLHELNFRSSSN
VWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIK
LLETEDFEKNTITTGWLDDLISQKMTAEKPDPTLAVICGAATKAFIASEAARQNYINSLK
KGQVPSKSLLQTMYPVEFIHEGKRYKFTVAKSADDRYTLFINGSKCEVRIRKLSDGGLLI
AIGGKSHTIYWKDEVSATRLSVDSMTTLLEAEDDPTQLRTPSPGKLVKFLVDNGDHIDGG
QTYAEVEVMKMQMPLVAQESGVVQLLKQPGSTIAAGDIIAILSLDDPSKVKHALPFEGML
PDFGAPIIEGTKPAYKFRSLETTLQNILNGYDNQVIMNPSLQELIKVLRDPQLPYSEWSM
QISALHSRLPPKLNEQLSQLVDRSSKRNALFPARQLNKLLESATKQPDSDPSLTPVVEPL
LDVTRRYANGLEAHEHSVFVKFLEEYYNVEKLFSSTTEDNVILKLRDEYSDNLEKVVVIV
LSHAKVAAKNNLILAILRHYQPLCKMSSQVASIISGPLKHIVELESKATARVALQAREIL
IQGALPSVKERSEQVEHILKSSVVRPTYGATNPKRSEPDMEVLKDLIDSNYVVFDVLTPF
LSYPDPAVAAAAAQVYVRHAYRAYTIGEVKVCEGTTTPICKWKFQMPSAAFTSIPQIKTK
FGMNRAISVSDLTYVADPENSPLRTGILVSAEHLDDVDDSLAQSLETIPNTSSSAAAAGP
VPDRSVSSSSLSNVTNVYVQSTDGFESEADVLSRLREILDSNKQELISSAIRRITFIFGY
SDGSYPKYYTFKGPAYEEDKTIRHIEPALAYQLELGRMSNFNIKPIFTENRNIHVYEAVG
KSTPLDKRFFTRGIIRTGRIRDDISIQEYLTSEANRLMSDILDNLEIIDTSNSDLNHIFI
NFSAVFDVSPEDVEAAFGGFLQRFGKRLLRLRVASAEIRIIIKDPETGAPVPLRALINNV
SGYVVKTELYTEVKNANGDWVFKSLGKPGSMHLRPIATPYPVKEWLQPKRYKAHLMGTTY
VYDFPELFHQALVSQWQKFSPKTKLNDNFFIANELIEDENGELTEVDREPGANTIGMVAF
KITAKTPEYPRGRQFVIVSNDITFKVGSFGPQEDEFFNKVTEYARKRGIPRIYLSANSGA
RIGIAEELVPLFQVAWKDPKDSTKGFDYLYLTSEGLRELKKYGKDHSVVTERVVENGEER
HLIKAIIGVDEGLGVECLRGSGLIAGATSKAYQDIFTITLVTCRSVGIGAYLVRLGQRAI
QVEGQPIILTGAPAINKVLGREVYTSNLQLGGTQIMYNNGVSHLTASDDLAAIEKILAWL
SYIPAKRNMPVPILETEDKWDREVEYFPPKEETYDVRWLIAGRDSPEGFERGLFDKDSFM
ETLSGWAKGVVVGRARLGGIPMGVIGVEIRTMQNLTPADPANPDSTESVSQEAGQVWYPN
SAFKTAQAIRDFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYKQPIMI
YIPPTGELRGGSWVVVDPSINKEHMEMYADKESRAGVLEPAGMVGVKYRREKLLATMSRL
DDTYRSLKEKLSDASLSPEEHQEISKKLSIREKQLLPIYSSISVQFADLHDRSDRMLAKG
VIRKELQWVNSRRFFFWRLRRRLNEEYLMRRLDVELPLASRLEKIARLRSWYPASVDHEN
DRQVASWIEENFQLLDEHLKALKLESFAQSLAKSLRSDHDNVITGLSEVLKMMSAEDKEK
IIKSLK
NT seq 7041 nt NT seq  +upstreamnt  +downstreamnt
atgtatttttttggttcgattgatcttcggcccgctgtttcctttgctcgctcggcttgt
ctgttcgtttgtctgtctaccttttttttttcgttcgtttttgtcttctctcttttcgac
aatccaacaacgtttcctatctcaatccaacaatattatacaagagaaaaaaataagaat
aaaaaaaaccaaacaacaaaaagattggattcagattgtagtggcagtaatactaacatc
aagacgatttctagcctctttagacaaatacgattcaattttgtgagcagtttaccacgc
ctgcgtttaacccgttgttttcattttaatagaactcaattgaagatgagtgaggagagc
ctttttgaagttagttcaaaagtgggagttgaagaaatagcggattatgcaaaagaacat
gcaaaattaccagcaagttttataggttacaggaccgtagataaagcggaagagagtcca
cttaaagatttcgttagaaaccatggtggtcataccgtcatttcaaagattctaattgca
aacaatggtattgcagctgttaaagaaatcagatctgtaaggaaatgggcttacgaaaca
tttggtgacgatagagctgttcaatttgttgcaatggcaaccccagaagatttagaggcc
aatgcagagtatattcgtatggctgagcaatacgtagaagttccaggtggtacaaacaac
aacaactatgccaatgtggatcttatcgttgaaattgcagaaagagctgacgttgacgca
gtatgggctggttggggtcatgcaagtgaaaatccagatttacctgagacgcttgcaaat
tctaaacgtaaaattcttttcatcggtccaccaggtaacgccatgagatctttaggtgac
aaaatttcatcaaccattgtcgcccagcacgcaaaggttccatgtattccttggtcaggt
acaggtgttgataaagttcgtattgattatgaatcaggtttagtgtgcgttgatgatgaa
atttataagcaaggttgttctacatccgcggaagatgggttagaacgtgctaagaagatt
ggattcccagtcatggtaaaggcctcagaaggtggtggtggtaaaggtattagacaagta
catcgtgcagaagatttcataccgttatacaaccaagcagccaatgaaattccaggttcc
cccatctttattatgaaattagcaggtagagcccgccatttggaagttcaattattagcc
gatcaatacggtgcaaatgtttcattatttggtcgtgattgttccgtacaaagacgtcat
caaaagattattgaagaggcaccagttaccattgccaaacctgatacctttaaggagatg
gagaaagctgctgtcagattgggtaaattagtcggttacgtttctgcaggtacagtggag
tatctttattctcatgatgatgatcaattctatttcttagaattaaatcctcgcttacaa
gtggaacatccaactacagaaatggttagtggtgtcaacttaccggcagctcaattacaa
attgcaatgggtatccccatgcatagaataagagacattagaatgctctacggtatgcac
cctcaacaatcgacaaagatcgattttgaatttgcaaacgaagaatcttccaccacacag
agaaagccaacgccaaagggtcattgtactgcatgtcgtattacatctgaagatccaaac
gaaggttttaaaccatccggtgggtcacttcacgaactaaattttagatcatcttctaac
gtttgggggtatttctccgtgggtaacaatggtggtattcattccttttcagattcccaa
tttggtcacatctttgcctttggtgaaaatagacaagcatctagaaagcatatggttgta
gcattgaaggaattatccattagaggtgatttcagaacgacagtggaatatttaattaaa
cttttagaaaccgaagattttgagaaaaatacaattactacaggttggttagacgatttg
atctctcaaaagatgaccgccgaaaagccggacccaactttagcagttatttgtggtgcc
gcaacaaaggcattcattgcatctgaagctgctcgtcaaaattatatcaattctttgaaa
aagggtcaagtgcctagtaaatccctgttgcaaaccatgtatccagtggaattcattcat
gaaggtaaacgttacaagtttacagtggccaaatctgcagacgaccgttatacacttttc
atcaatggatccaaatgtgaagttcgtatacgtaaactgtctgatggtggtcttttgatt
gccattggcggtaaatcacatacgatttactggaaggatgaagttagtgctaccagattg
tctgtggattctatgactactttattagaagcagaagatgatccaactcagctacgtact
ccatcccctggtaaattggttaaatttttggtggataacggtgaccacatcgatggtggc
caaacctacgctgaagtggaagtcatgaagatgcaaatgccgctagtggcacaagagagc
ggtgtggtacaattattaaagcaaccaggttccaccatcgctgctggtgacattattgcc
attttaagtttagatgatccatccaaggttaaacacgcattaccttttgaaggtatgtta
ccagacttcggtgctcctataattgaaggtactaagccagcttataagttcagatcatta
gagactactttacaaaacattttgaatgggtatgataaccaagtaattatgaatccatct
ttgcaagagttaatcaaagttctaagagatcctcaattaccttactctgaatggtccatg
caaatctccgcattgcattctagattaccaccaaagttgaatgaacaattgagtcaattg
gtggaccgttcctccaagagaaatgcccttttccctgctagacaattgaataaactattg
gaaagtgcaacaaaacaacctgattctgatccttcgttgacacctgtggtggaaccatta
ttggatgtcactcgccgttatgccaacggtttagaagcccatgaacactctgtttttgtg
aaattcttggaagagtattacaacgtggaaaaactgtttagttctaccaccgaggacaac
gttatcttgaaattgagagatgaatattccgacaatttggaaaaagtggtggtcatcgtt
ctatctcacgctaaggtcgccgctaagaacaacttgattttagccattttgagacactac
caacctttgtgtaagatgtcttcccaggtggcttccattatctcaggtcctttaaaacac
attgtggaattggaatcaaaggctactgctagggttgccttgcaagctagagaaattcta
atccaaggtgctctaccatctgttaaggaaagatctgaacaagtggaacacattttgaaa
tcatctgtggttagacctacttatggcgcaaccaatccaaaacgttcagaacctgatatg
gaagtcttaaaggacttgattgattccaactatgtggtttttgatgttttgactccattc
ttgagctacccagatcctgctgtggcagctgctgcagctcaagtttacgttcgtcatgct
tacagagcttataccattggtgaggtcaaagtttgtgaaggtactactacaccaatctgc
aaatggaaattccaaatgccatctgcagctttcacctctattccacaaattaaaactaaa
ttcggtatgaacagggctatctctgtctctgatttgacctacgtggctgatcctgaaaat
tctccactaagaactggtatcttggtgtctgccgaacacttggacgatgtggatgattct
cttgcccaaagtttggaaacaatccctaacacatcttcttctgcagcagctgctggtcct
gttcctgacagatctgttagctcttcatctttgagtaatgtgactaacgtttacgttcaa
tccactgatggctttgaatctgaagccgatgtcttgagcagattgagagaaattttagat
tccaacaagcaagaattgatctcctctgctatccgtcgtattacatttatctttggttac
agtgatggttcttatccaaagtattacactttcaagggacctgcttatgaggaagataag
accattcgtcacattgaacctgccttggcttaccaattggaattgggaagaatgtccaac
ttcaacatcaagccaatctttactgaaaacagaaatattcacgtttatgaagctgttggt
aagagtactcctttggataagagattcttcactagaggtatcattagaaccggtcgtatc
cgtgatgacatttctatccaagaatatttgacctctgaagccaatagattgatgagtgac
atcttggacaacttggaaattattgatacttctaactctgacttgaaccacatctttatc
aacttctctgccgtatttgacgtttctcctgaagatgtggaagctgcctttggaggattc
ttgcaaagatttggtaagagattattgagattgcgtgttgcctctgctgagatccgtatc
attattaaggatcccgaaactggcgcaccagttcctctacgtgcattaatcaacaatgtc
tctggttatgttgttaagactgagttatacaccgaagttaagaatgcgaacggtgattgg
gtctttaaatccttgggtaaaccaggatccatgcatttaagacctattgccacaccatac
cctgtaaaggaatggttgcaaccaaaacgttacaaggcacacttgatgggcacaacttat
gtgtatgatttccctgaactattccatcaagcccttgtctcacaatggcaaaaattctct
ccaaagactaagttgaacgataatttcttcattgccaatgaattgattgaagatgaaaat
ggtgaactgactgaagttgaccgtgaaccaggtgctaacactatcggtatggttgctttc
aaaattaccgccaagacaccagagtaccctcgtggtcgtcaatttgtgattgtctccaac
gatatcactttcaaggttggttctttcggacctcaagaagatgaattcttcaataaggtt
actgaatacgccagaaagcgcggtattcctagaatctacttgtctgccaactctggtgct
agaatcggtattgctgaagaattggtcccattattccaagttgcatggaaggatcctaag
gattctacaaagggatttgattacttgtacttgacatctgaaggtttaagagaactaaag
aaatacggtaaggaccatagcgttgttactgaacgtgttgtcgaaaacggtgaagaaaga
catttaatcaaggctatcattggtgtcgatgaaggtttaggtgtggaatgtttgagaggt
tctggtttaattgctggtgccacttcaaaggcctaccaagatatcttcaccattactttg
gttacttgtagatccgtcggtattggtgcttacttggttagattgggtcaaagagctatt
caagtggaaggtcaacctatcatcttgactggtgcaccagccatcaataaggtgttaggt
agagaagtctacacttctaacttgcaactcggtggtactcaaattatgtacaacaatggt
gtttctcatttgaccgcttctgatgatttggctgctattgaaaagattctagcatggttg
tcctacattccagctaagcgtaacatgccagtaccaatcttggagactgaagataaatgg
gatagagaggtggaatacttcccacctaaggaggaaacttacgacgtgagatggttaatt
gccggtcgtgattctcctgaaggattcgaaagaggtttgttcgacaaggactcctttatg
gaaacactttctggctgggctaaaggtgttgttgttggtagagctcgtctaggtggtatt
ccaatgggtgtcattggtgtcgaaattagaaccatgcaaaacttgacccctgcagatcct
gctaacccagattctactgaatctgtgtctcaagaagctggacaagtgtggtaccctaat
tctgctttcaagactgctcaagctatccgtgatttcaaccatggtgaacaattgccttta
atgatcttagctaactggagaggtttctctggtggtcaaagagacatgtacaacgaggtc
ttgaaatatggttcctttatcgtcgatgctcttgtcgattacaagcaacctattatgatt
tacattcctccaacaggtgaattgagaggtggttcctgggttgttgttgatccatcgatc
aacaaggaacacatggaaatgtatgccgataaagaatctagagcaggtgttttggaacca
gctggtatggttggtgtcaaataccgtagagagaagttgttggccactatgtctagattg
gatgacacctacagatcattgaaggagaaattatctgatgcatctttgagcccagaagaa
catcaagaaatttccaagaaattgtccatccgtgagaaacagttgttaccaatctacagt
tccatcagtgtccaatttgccgacttacacgacagatctgaccgtatgttggctaagggt
gtgattagaaaagaattacaatgggttaattctcgtcgtttcttcttctggagattgaga
cgtagattgaacgaggaatatttgatgagaagattggatgttgaattaccacttgcttcc
aggttggaaaagatcgccagattgagatcttggtacccagcatctgttgaccatgaaaat
gatagacaagtggcctcttggattgaagaaaacttccaattgttagatgaacatttgaag
gctttgaaactagaatcctttgctcaaagcctggctaaatctttgagaagtgaccacgat
aatgttataactggtctctccgaagtgttgaagatgatgtccgctgaggataaggagaag
atcatcaaaagcttgaaataa

DBGET integrated database retrieval system