KEGG   Zygosaccharomyces rouxii: ZYRO0D09240gHelp
Entry
ZYRO0D09240g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ZYRO0D09240g
Enzymes [BR:zro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ZYRO0D09240g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:794163..796271
Genome map
AA seq 702 aa AA seqDB search
MRLLKLLSALYLIIGIARSSSVSSDYDGEFEPRAPLGEKEFRQELKSGLHLVEFYSPYCP
HCRDFAPTWHETWRKFRKEGERLNISFVQVNCVKDGDLCYDEAITEYPAIKLYGPEGFIK
NYPNEYERTEGDLINFARQEALDPINMEATDLEISSKFLNAQDFNELLAGKGKQPYLVSF
WPSDDHEDPLAGSKSYDFCPECQTFQKLWPQITKKLLLQGVATGHINCETLPNLCHEMEF
HKLVNGAQAVDNYPRVALVLPGKGVNNLFIYENGFSSSVWSYEDFAVRAISNSEAPEITL
EQIVELVRQDFQFPESKNLPVPSQALHVVFAYSPENVVTEDFHVLEHLVKHLAKVPNAYL
HKSKDDVSTAAKVSLDYMYEKINYNRSEPVKLPKTDYLELNLVPQSPTFYIFKEGDWVPH
LYVGDSTTETRNVEALAKWFNESALPVISEVTPYNFGQLLSFQPSDYDAVAIQLVDLTDA
ESIKTSNEQLKNFIKAAYDYEDVRMQNVVNVRAEKRANKNKRIKELKAAKASSDKIGKVY
HEEIKFEDKNKVILGYVDISKGPHVLEDLGFHRGRDDYKSGDVLVVDSYSSAFTEKDVFG
NRLTTDSMYALRETLVKLILPELSHFHERLESQELSFNYSRGLDIFEPMRKHKVWRYFFI
VGALVLIVKAPSFYKKFKSNKKYKAKRSTVGILGQPSKRSKD
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgagattgctgaaattgttaagtgcattgtacttgataataggtattgcaagatctagt
agtgttagtagtgattatgatggtgaatttgaaccgagggcacccttgggagaaaaagag
ttcagacaagagttaaagagtggattacatctggtagaattctatagtccatactgtcct
cactgtcgtgactttgcaccaacttggcatgaaacgtggaggaaatttcgtaaagaaggg
gagaggttaaacatttcattcgttcaagttaactgcgttaaagacggtgatctatgttat
gatgaagctataacggaatatcctgccattaaattatatggtccagaagggtttattaag
aattatccaaatgagtatgaaaggacagagggagatctgattaactttgctcgtcaagag
gccttagatccaataaatatggaggcaacagatttagaaatctcgagtaaatttttaaat
gcacaggattttaacgaattattagctggtaaagggaagcaaccttatttagtatcgttc
tggccaagtgatgatcatgaagatccattagctggaagtaagagttacgatttttgtcca
gaatgccaaactttccaaaaactttggcctcagattaccaaaaaattgttgcttcaaggt
gttgcaaccggtcatatcaattgtgaaactttacccaatttatgtcatgaaatggagttc
cacaaattggttaatggtgcacaagcagtggataattacccacgagttgccctagtactc
ccaggtaagggtgtaaacaatctttttatctatgaaaacggattttctagttctgtctgg
tcctatgaagattttgcagttagagccatttctaactctgaagcaccagaaatcacactt
gaacaaattgtggaattagtccgtcaagatttccaatttcctgaaagcaagaatcttccc
gttccatctcaggctctccacgttgttttcgcttacagtcctgaaaatgtagtaactgag
gatttccacgttcttgaacacttggttaagcatttggctaaagttcctaatgcgtattta
cacaaatcgaaggatgatgtttccacggcggcaaaggttagtttggactacatgtatgaa
aaaataaattataacagaagtgagcctgtaaagttaccaaagactgattatttggaattg
aatttagttcctcagagtcctactttttacatcttcaaagaaggtgattgggtacctcat
ttatatgttggagattctacaacagagacaagaaacgttgaagctttggctaaatggttt
aatgaatctgcattacctgtaatcagtgaagtgacaccttataatttcggtcaattgttg
agtttccaaccttctgattatgatgcggtggcaatccagctggtcgacctgactgatgct
gaaagtattaaaacaagcaacgaacagttgaaaaatttcattaaggcggcttatgactac
gaagatgttagaatgcaaaatgtggtcaacgtacgtgctgagaaaagagctaataagaat
aaaagaatcaaagaattgaaagctgctaaagcatcttctgataaaattggcaaagtttac
catgaggaaattaaatttgaagataaaaacaaagtaattctgggttatgtggatatttct
aaaggaccgcatgttctagaagatctcggattccataggggtagagatgactataagagt
ggtgacgttcttgtggttgatagttactctagcgcctttacggagaaggatgtttttggt
aatagattaacaacagattcaatgtatgcattaagggagactttagtcaagctaatttta
ccagaactatcacatttccatgaacgtttagaatctcaagaattatccttcaactatagc
agagggttggatatctttgaacccatgagaaagcataaagtatggcgctatttcttcatc
gttggtgctcttgttctaatcgtcaaggcaccatcattttacaagaaattcaagtctaat
aagaagtataaggccaaaagaagtactgttggaatattagggcaacctagcaaaagatca
aaggactaa

DBGET integrated database retrieval system