KEGG   Zygosaccharomyces rouxii: ZYRO0D11682gHelp
Entry
ZYRO0D11682g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    ZYRO0D11682g
  Amino acid metabolism
   00380 Tryptophan metabolism
    ZYRO0D11682g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     ZYRO0D11682g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(981098..982573)
Genome map
AA seq 491 aa AA seqDB search
MNFESILLAIPLIIVGYVGYRVVFPPWNFPKNIPTIPFYVIFLPSILNIDQTELYHLYLK
EPLEKYGAAKLFFGSRWNIIVTKPQMLAQVFKDEDVFAKSGNQKKIPHSVIAAYTGDNVI
SAHGQVWKLYRSIVTNGLQHFDESPIFRNAKLLGNIIGERFEQENKKEVSISMTGLVQRL
CLDNISQVVLGFDFATLTSDKSPLHDHLMRIKKQIFHPFFLTFPFFDHLPIPARRRGFKD
VEQFRKQLVEHVDDQLVKNYKFEQTTFAASDLIRAYNKDHINRKQLTDNIVILLVAGHEN
PQLLLTTSLYLLAKYSQTWQRRIREEIMNVFDSKKLLESPLLNSFLYEAVRVYPPLNTII
NRCTSKTCLLGTNVVIPKGTYVGYNNFGTNHDKTSWGPDADEFKPERWGDDMESITKNWK
HAKNACKVSSFHGGRRACLGEKLALAEMRITIAEILRNYEWTLAPEWDEKMTPAGPLAPL
NLKLNFRKVNV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaatcaattttattagctataccattgataatagtggggtacgtcggttac
agggttgtattcccaccgtggaattttccgaagaatatccccactataccattttatgtc
attttcctcccatcaattctcaatatcgaccaaactgagctgtaccatttgtatctcaag
gagccattagagaagtatggagctgctaagctgttttttggttcacgttggaatataatt
gtaactaaaccacagatgttggctcaagtgtttaaagatgaagatgtatttgcaaagagc
gggaatcagaagaaaattccacatagcgtgatcgcagcctatacgggagataacgtcatt
agcgctcatgggcaggtttggaaactttatcgatcaattgtaaccaacggattacaacat
tttgacgaaagtccaattttcagaaatgctaaattgttaggaaatattattggtgagaga
ttcgaacaagagaataagaaagaagttagtatttcaatgacaggattggttcagcggtta
tgtttggataatatttcacaggtagtcttagggtttgattttgcgaccttaaccagtgat
aaatcgccattacatgaccatttgatgcgtataaagaagcagatttttcacccatttttt
ctaactttcccattcttcgaccatttaccaattccagctaggagaaggggatttaaagat
gtggaacaatttcgtaagcagttggtagaacatgtagatgatcaactggtgaaaaattat
aagttcgaacagaccacatttgccgctagtgacttgattcgtgcctacaacaaggaccat
ataaatcgtaaacaattgaccgataatattgttatcctgctagtagcaggacacgaaaat
ccacaattgttattaaccacttccttatatttattggccaaatattcccaaacatggcag
aggagaattagagaggaaattatgaatgtatttgattccaaaaaattattagaatcacca
ctgttaaacagctttctttatgaagcagttagggtatatccaccattgaatacaattatt
aacagatgtacttcaaaaacttgtctcttgggtacaaatgtggttattccaaagggaacc
tacgtgggatataacaattttggtacgaatcacgataaaacttcttggggacctgatgca
gatgaatttaaacctgaaagatggggagatgatatggaatccattacaaaaaattggaag
catgcaaagaatgcctgtaaagtcagcagtttccatggtggacgtcgtgcatgtcttggt
gagaagttggcattagctgaaatgagaattactatagcagaaattttgaggaattatgaa
tggacattggcacctgaatgggatgaaaaaatgacacccgcgggacccttggcgccatta
aatttaaagttaaatttcagaaaggtaaatgtataa

DBGET integrated database retrieval system