KEGG   Zygosaccharomyces rouxii: ZYRO0D13706gHelp
Entry
ZYRO0D13706g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ZYRO0D13706g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ZYRO0D13706g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(1148881..1149444)
Genome map
AA seq 187 aa AA seqDB search
MSRPIVFSGPSGTGKSTLLKKLFAEFPDKFGFSVSSTTRSPRPGEVNGREYNFVQVEQFQ
KMIQEGKFIEWAQFSGNYYGTAVDSVKKVIESGKVCLLDIDMQGVKAVKSSDLNARFLFI
APPSVEDLESRLRGRGTETEESISKRLAAAKGEMDFASTGVHDKIIVNDDLNRAYDEMKQ
FILATEK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcccatcgttttttcaggtcccagtggtaccggtaaatcaacactcttgaag
aaactatttgcagaatttcctgataaatttggattcagcgtttcttctactactagatca
cctcgtccaggtgaagttaatggtagagagtataatttcgttcaagtagaacaatttcaa
aagatgatccaagaaggaaaatttattgaatgggcacaattttctggtaattactacggt
actgctgtggatagtgttaaaaaagtcattgaatcaggtaaagtttgtctattggatatt
gatatgcaaggtgttaaagctgtcaaatcatccgatttgaacgctagattccttttcatt
gcaccaccatcagtagaagatttagaaagcagattgagaggaagaggtactgaaaccgaa
gaatctatcagcaagagactagcggcagccaagggcgagatggattttgcctctactggt
gtccatgacaaaataattgtcaatgacgatttgaacagggcatatgatgagatgaagcag
tttattctcgcaactgagaaataa

DBGET integrated database retrieval system