KEGG   Zygosaccharomyces rouxii: ZYRO0D15202gHelp
Entry
ZYRO0D15202g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:zro00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1278034..1279659
Genome map
AA seq 541 aa AA seqDB search
MQGPLKSLAPNARVGVVGGGISGLTFSYFLAKLRPDVHVTVFESKPRTGGWIRSLDTQDN
EGSPIMLEQGPRTLRGVSDGTVLMADILKDLKRHSLLQYVRKRSRANKKFLLDTNDQLVQ
VPNSLMSALRFCFNPMGKGVLSGYLGERFRSKDSRPPGGDESVHSFISRRTGNELVSTNL
VSAVCHGIYADDVKKLSARKVMGKFMDYEAQYGSIIKGSKKVNSQNKKSLSASGLTPLIS
LYRDAFSKDKYELARLIRDFSKYPMIGLSGGLETFTRSLTQELDKWPNVNLELQRQVQSV
SKDPLSNRITVKTTEGPPVGDFDHLRITTNPSTWKETGLFNDQLSQKLLQRPQSNTVLLV
NYYWPHEDLLLKNQQGFGYLVPQNRKNPEQLLGIIFDSVIEKNYNAYYPGFTKDMFTGLS
KRQEYTKLTVMLGGHYLKERHTVPTAEETILAAKQALHNHLGISQQPLDNGTWKFVVAQD
CLPHFFVGYSQWKHQVEQEVLNKFAGHISLGGMGFARGPGVPDVVTDSFMDVYKMVQDSK
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcccattaaaaagtttagcaccaaatgctcgagttggtgtagttggtggaggg
atatctggattgacttttagctatttcctagccaaattgagacctgatgtacatgtaact
gtattcgaatcgaaaccccgaacaggaggttggatccgctcactggacactcaagacaat
gagggtagtccaattatgttggaacaaggtccaaggactttaagaggtgtttcagatggt
actgttcttatggcagatatcctcaaagatttgaaaaggcattctttattacagtacgtg
cgaaagaggtctagagccaataagaagtttttgttagataccaatgatcaattggtacag
gttcccaattctttgatgagtgcactaagattttgcttcaatcccatgggtaaaggagta
ctgtctggctatttaggtgaaaggtttagaagtaaggattcaagaccgccaggcggtgat
gaaagtgtgcattcatttatcagtagaagaacgggtaatgaattggtttcaaccaatttg
gtaagtgcggtgtgtcatggtatttatgccgatgacgtcaaaaagttaagcgctcgtaaa
gttatgggcaaatttatggactatgaagctcaatatggttcaataattaaaggttctaag
aaggtcaactcccaaaataaaaagagcctcagcgcttcaggtttaacacctctaatttca
ttgtatcgagatgcgtttagcaaagacaaatacgaattggcgagattgatcagagatttt
tctaaatatcccatgataggattatcaggtggattggaaacttttacccgctcactcacg
caagaattagacaaatggcccaatgtaaatctagaattacaaagacaagtgcaaagcgtt
agcaaagatcctctcagtaatcgtattaccgtaaagaccaccgaaggtcctccagttggt
gattttgatcatttgcggataacgacgaatccttccacatggaaggaaacagggttgttc
aacgatcaattgtcacaaaaactcttacaacgtccccaatcgaatacagtactcctagtc
aattactactggcctcatgaggatcttttacttaaaaatcaacaagggtttgggtattta
gtcccccaaaaccgtaaaaacccagaacaacttctgggaatcattttcgattccgttatt
gaaaagaattacaatgcatactaccctggctttaccaaagatatgtttacaggactttcg
aaaaggcaagaatacaccaaattaacggtaatgttaggaggtcactacctaaaggaacgt
catactgtacctactgcagaggaaacaatccttgctgcaaaacaagccctacataaccat
ttggggatttctcaacagcctttagataatggtacttggaaattcgtagtggcccaagat
tgtctaccgcattttttcgtcggttattcgcaatggaaacatcaggtggaacaagaagtg
ctaaacaaatttgcaggtcatatctcattaggtggtatgggatttgccaggggtcctggg
gtacccgatgtagttacggattctttcatggatgtctacaagatggtacaggattcgaag
gcatga

DBGET integrated database retrieval system