KEGG   Zygosaccharomyces rouxii: ZYRO0E02662gHelp
Entry
ZYRO0E02662g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K03264  
translation initiation factor 6
Organism
zro  Zygosaccharomyces rouxii
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:zro03008]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:206336..207073
Genome map
AA seq 245 aa AA seqDB search
MAARAQFENSNEIGVFSKLTNSYCLVAVGGSENFYSAFEAELGDSIPIVHTTIAGTRIIG
RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD
IDRETEELIGDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTSVQDQDELSSLLQVP
LVAGTVNRGSNVVGAGIVVNDYLAVTGLDTTAPELSVIESIFRLHDAQPESIQGNLRDTL
IETYS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctgccagagcacaattcgaaaattcaaatgaaatcggtgtcttctcaaaactcacc
aactcctactgtctcgtcgctgtaggcggctccgagaacttttactcagctttcgaagct
gagttaggtgattccatccctattgttcatacaacaattgcaggtacccgtataattggt
agaatgaccgcaggtaaccgtcgtggtcttttagtccccacacaaactactgatcaagaa
ttacagcatttgagaaatagtttacctgattctgtcaagattcaacgtgtcgaagaaaga
ctatcagctttaggtaatgtcatctgttgcaacgattatgttgcgcttgttcatcctgat
atcgatagagaaactgaggaactaataggtgatgtattgggtgttgaagttttccgtcaa
acaatttccggtaatatcttagtgggatcttactgtgcgttgagtaaccaaggtggttta
gttcatccacagacttctgtgcaagatcaagatgaattgtcttcccttttacaggtacca
ctagtagcaggtacagttaacagaggttcaaacgtcgttggtgcaggtatcgtcgttaac
gattatctcgcagtaacgggtctggacactactgctccagagttaagcgttatagaaagt
atcttcagactgcatgacgcacagccagaatcaatccaaggtaatctaagagatactttg
atcgagacctactcttga

DBGET integrated database retrieval system