KEGG   Zygosaccharomyces rouxii: ZYRO0E03828gHelp
Entry
ZYRO0E03828g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:zro00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:289636..291756
Genome map
AA seq 706 aa AA seqDB search
MGADSEIPENVRGVVEFDSWLKPFVHVLSERRYLGDKWHYDITHATPDGSYQSLSKFARD
SYRSYGLHADWETGEIRYREWAPNAQKAFLIGEFNNWNESSHELKSKDEFGVFHITIPPN
ADGSFAIPHDSKIKVMFVKPDGSKIYRLPAWITRATQPDRETAKAYGPGYEARFWNPEKP
YEFKNKRPHFNQKVDSLRIYEAHVGISSPEPKVASYKEFTQNVLPRIKHLGYDAIQLMAI
MEHAYYASFGYQVTNFFAASSRYGTPEELKELIDTAHGMGILVLLDVVHSHASKNAEDGL
NEFDGSDHQYFHSIDSGRGSHPDWDSRLFNYGSFEVQRFLLANLAFYIDVYQFDGFRFDG
VTSMLYLHHGVGPSGAFSGNYNEYLSKEKSGVDHEAVAYLMLANDLVHELLPQSAITIAE
DVSGYPTLCLPRAMGGIGFDYRLAMALPDMWIKLLKEQKDEDWEMGDIVHTLTNRRHGEK
VVAYCESHDQALVGDKTLAFWLMDAAMYTDMSVLKPATLVIDRGMSLHKMIRLLTHSLGG
EAFLAFEGNEFGHPEWLDFPNVNNGDSFHYARRQFNLADDNLLRYRMLYEFDAAMQNCER
KHQWLNTPQAYVSLKHEGDKVIAFERNGHLFMFNFHPTKSYTDYRFGVDVAGTYKIVLNS
DRKEYGGYDRVDESARFFTTDLAWNGRKNFIQVYIPSRVALVCALE
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgattcggaaattccagaaaacgtcagaggcgtcgttgaatttgatagctgg
ttgaaaccattcgttcatgttttgtcagaaagaagatatttaggtgataaatggcattat
gatattactcatgctacccctgatgggtcttatcagtcgttgtcaaagttcgctagggat
tcgtacagatcatacggattgcatgcggattgggagactggagagataagatatagagaa
tgggcgcctaatgctcagaaagcgtttctcattggtgaattcaacaattggaatgagagt
tctcatgaattgaaatccaaggatgagtttggtgtgttccacatcactataccacctaat
gcggatgggtcgtttgccattccgcacgattctaaaataaaagttatgtttgttaaacct
gatggttccaagatttacagattgccagcctggattacaagagccacacagcctgatcgt
gagactgcgaaggcgtatggccctggatatgaggcaagattttggaatcctgaaaaaccg
tatgagtttaagaataagagacctcatttcaaccaaaaagtggactcgttaagaatttat
gaagcgcatgttggaatttcatcaccggaaccaaaggtagcctcttacaaagaattcact
caaaatgttttaccaaggattaaacatctggggtacgatgccattcaattgatggctata
atggagcatgcttattacgcaagttttggctaccaggtgaccaattttttcgctgcaagt
tcccgttatggtactcccgaggaattgaaagaattgatagataccgcccacggtatggga
attctcgtgctgttagatgtggtacacagtcatgcttccaagaatgcagaggatggactc
aacgaatttgatggttccgatcaccagtactttcattctatagattctggtagaggtagt
catccagactgggactcgagattgtttaactacggaagttttgaggtgcaaagattcttg
ttagccaatttagctttttacatcgacgtctatcagtttgatggtttcagattcgacggt
gtcacttctatgctttatctgcaccatggtgtggggcccagtggggcatttagtggtaat
tacaacgagtacttatcgaaggaaaagtcgggtgttgaccatgaagctgttgcatatctg
atgttagcaaacgatctggtccatgaattactaccgcaatctgctattaccattgctgaa
gatgtttctggttaccccacattgtgtctaccaagagcaatgggaggtatcgggtttgat
tacagattggctatggcgctaccagatatgtggattaaactcttgaaagagcaaaaagat
gaagattgggaaatgggggacattgttcacactttaaccaatagacgtcatggtgaaaaa
gtggttgcttattgtgaatcacacgatcaagcattggtcggtgataaaactctagcattt
tggcttatggatgctgctatgtacacagacatgtcggtcttgaaacctgcaactttggta
atcgatcgtggtatgtctttacacaaaatgatcagattgttgacgcattctctaggtggt
gaagcatttttagcattcgaaggtaatgaatttggccatcctgagtggttagatttcccc
aatgttaataatggtgacagtttccattatgctcgtagacaattcaatttagcagacgac
aacttgttacgttacagaatgttgtatgaattcgatgccgctatgcaaaactgtgaaaga
aaacaccagtggctaaatacaccgcaggcatacgtctctttaaaacatgaaggtgataag
gtaattgcgtttgagcgtaatggacatttgttcatgtttaatttccatcctactaaaagt
tatactgattacagatttggtgtggatgttgcgggtacttataaaattgttttgaattcc
gatcgtaaagaatatggcggttacgatagagttgatgaaagtgcaagatttttcaccact
gatttagcatggaatggtagaaaaaactttattcaagtttatatcccatccagggtagca
ctggtttgcgcccttgagtaa

DBGET integrated database retrieval system