KEGG   Zygosaccharomyces rouxii: ZYRO0E05566gHelp
Entry
ZYRO0E05566g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ZYRO0E05566g
Enzymes [BR:zro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ZYRO0E05566g
Glycosyltransferases [BR:zro01003]
 Polysaccharide
  Storage polysaccharide
   ZYRO0E05566g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:427628..429745
Genome map
AA seq 705 aa AA seqDB search
MGRDLQNSLVFEVATEVANRVGGIYSVLKSKAPVTVAQYGDNYTLMGPLNNGTWQSEVEE
LDWTANETFTEELRPLQSVLKSMHSRGVRFVFGRWLIDGSPRVILFKLDSVRGFLNEWKG
DLWSLVGIPSPEHDPETDDAIILGYMVAWFLGELAHLDHKHTIVTHCHEWLASVALPLCR
KRRIDVVTIFTTHATLLGRYLCAAGNIDFYNNLAHFDVDHEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITALEAEYLLKRKPDGILPNGLNVVKFQAVHEFQNLHAIQKEKINEFVRGH
FHGCFDFDLDNTLYFFTAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIIMPAK
NKSFTVEALKSQAAVKALENSVAEVTRSIGKRMFEYAMRYPHMGVHSEIPQDLDELLRPS
DKILLKKRVFGLRRAEGELPPVVTHNMVDDANDPILNQIRHVALFNHSSDPVKIIFHPEF
LNQNNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IEVDQAKDYGIYIVDRRFKAPEESVEQLVDYMEDFCKKNRRQRINQRNRTERLSDLLDWR
RMGLEYVKAKQLALRRAYPESFRQLVGEELNDLNMETLAGDKKIKIARPLSVPGSPRDRA
NSVSSAVYMTPGDLGTLQDANNADDYFSLAVDDKEDEEDRVYYDE
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtgatttgcagaatagtttggtgttcgaggtcgctactgaagtcgctaatagg
gttggcggcatatactcggtcttaaaatcgaaggcgccagttactgtcgctcagtatggc
gacaactatacgctaatggggccactaaataatggcacctggcagagtgaagtagaagaa
ttagattggactgctaatgaaacgttcaccgaagagctaagaccattacaaagcgtttta
aaatcgatgcattcaagaggtgtaagatttgtttttggtagatggttaattgacggttcg
cctagagtaatcttgtttaagttagattctgttcgggggttcttaaacgaatggaaggga
gatctttggtcgttagttggaattccatcacctgaacacgatccagagacggatgatgct
attatcttgggttacatggttgcttggttcttgggagaattagcgcacttggatcataaa
catacaattgtcacacattgtcatgaatggttagctagtgtagcactacccttgtgtcgt
aagagaagaattgatgttgttacgatttttactacgcatgcaactcttttaggtcgttat
ctttgtgctgcaggtaatattgatttttataacaatttggcacattttgatgttgatcat
gaagctggtaaaaggggtatttaccacagatattgtattgaaagagcagcagcacatact
gcagatgttttcactactgtttcgcaaatcactgcattagaagctgaatatcttttaaaa
agaaaacctgacggaattctgcccaatggtttaaatgttgtcaagtttcaagcagttcat
gagtttcaaaatttacacgcaatacagaaggaaaagattaatgagttcgtcagaggtcac
ttccacggatgttttgattttgatttagataatacgctttatttttttaccgctggtagg
tatgaatacaagaataagggagcagatatgtttattgaggcattagcaagattaaactat
cgtttgaaagttagtggatctaaaaagacggttgttgcatttataatcatgccagcaaaa
aataaatcatttacagtagaagcacttaaatctcaagctgcagttaaagcattagaaaat
tctgttgcggaagttactagatcgattggtaaacgtatgtttgaatatgcaatgagatat
ccgcacatgggggttcattctgaaattccacaagatttggatgaattattaaggccttca
gataaaattttactaaagaagagagtttttggtcttagaagagctgaaggtgaattgcca
ccggtagtaacgcataatatggtggacgatgctaatgacccaattttaaatcaaattaga
catgttgcacttttcaatcattcttctgatcctgtaaaaattatttttcatcctgaattt
ttaaatcaaaacaatccaattttaggcttagattatgatgaattcgtccgcggttgtcat
ttaggtgttttcccatcatattatgaaccatggggctatacacccgctgaatgtacagtt
atgggagttccatctataactacaaatctatcagggtttggtgcttatatggaagattta
attgaagtggatcaagcaaaggattatggtatttacattgtcgatcgtcgttttaaggct
cctgaagaatccgttgaacaattagtcgattacatggaagatttctgtaagaaaaacaga
aggcaaagaattaaccaaagaaatagaactgaacgtttaagcgatttactagattggaga
cgtatgggtttggaatacgttaaagctaagcaactagcattgcgtagagcttatccagag
tctttccgccaattagtgggtgaagaattaaatgatttgaatatggaaactttagcaggc
gataagaaaattaaaattgcaagaccattaagtgttccaggatcacctcgcgacagagcc
aatagcgttagtagtgccgtctacatgactcccggtgatcttggaactttacaagacgct
aataatgccgatgactatttttcactagccgtagacgataaggaagatgaggaagatcgc
gtctattatgacgaatga

DBGET integrated database retrieval system