KEGG   Zygosaccharomyces rouxii: ZYRO0E05654gHelp
Entry
ZYRO0E05654g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ZYRO0E05654g
   00052 Galactose metabolism
    ZYRO0E05654g
   00500 Starch and sucrose metabolism
    ZYRO0E05654g
   00520 Amino sugar and nucleotide sugar metabolism
    ZYRO0E05654g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ZYRO0E05654g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(437437..438939)
Genome map
AA seq 500 aa AA seqDB search
MSYQKKHIKTHSTYAFENNTNAVAASQMRNALNKLADSVRDDENLRNRFENELDSFFSVF
RRYLVEKSSGNTLLWEKIKSPTQEEVIDYGSLKPTHDDISNLSKLAVLKLNGGLGTSMGC
VGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANRI
RIRPFNQSRFPRVFKDSLLPVPSHYDDELDSWYPPGHGDLFESLHASGELDALLAQGREI
LFVSNGDNLGATVDFKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQV
PKEHIDEFKNIRKFKNFNTNNLWINLKAVKRLVESSSLSMEIIPNQKTIKRGGQEINVLQ
LETACGAAIRYFEGAHGVVVPRTRFLPVKTCSDLLLVKSDLFFLEHGSLKLDPSRFGPNP
LIKLGSHYKKVSDFNGRIPHIPKIVELDHLTITGNVNLGKNVTLKGTVIIVCSDGQSIDI
PNGSVLENVVITGNLQILEH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatcagaagaaacatatcaagacacattctacttatgcctttgaaaacaacacc
aatgcggtggcagcatctcagatgagaaatgctttgaacaagttagcagattctgttaga
gatgacgaaaacttgcgtaatagatttgaaaacgaattagattcgtttttctcagtattt
agaagatatttggtcgagaaatcatccggaaacactttattgtgggaaaaaattaaatct
cctactcaggaggaggttatcgattacggatcattgaaacctacacatgatgacatttca
aatctttctaaattggctgttcttaaattgaatggtggccttggtacttcaatgggttgt
gtgggacctaaatccgttattgaagttagagatggaaacacattcttagatctctcggtg
agacaaattgaatatttgaatagacaatacgatagtgatgttcctctattgttaatgaat
tctttcaacacggataaggatactgaacatttgattaaaaaatactcagctaatagaatt
cgtattagaccttttaaccaatcaagatttcctcgtgtttttaaggattcattattacca
gttccctctcattatgatgatgaattagattcctggtacccacctggtcatggtgacctt
tttgaatcgttgcatgcatcgggtgaattagatgctcttttagctcaaggtagagaaatc
ctatttgtctccaatggtgataatttgggtgctactgtggatttcaagatccttaaccat
atgatcgaaactggagctgaatatattatggaattgactgataagacaagagctgatgtc
aagggtggtactttaatttcttatgacggccaagttcgtctattagaagttgcacaagta
ccaaaggaacatattgatgaatttaaaaatattagaaaattcaagaattttaacactaac
aatttatggattaatttgaaagctgttaaaagattagtggaatcaagttcgttatcaatg
gaaattattcctaaccaaaagaccataaagcgcggtggtcaagaaattaacgttttacaa
ttagaaactgcctgtggtgctgccattagatatttcgaaggtgctcatggtgttgttgta
ccaagaacaagatttttgcctgtgaagacgtgttctgatctgcttttggttaaatctgat
ttattctttttagagcatggatctttgaaattagatccatcaagatttggtccaaatcca
ttgattaaattaggttcacactacaaaaaagtttctgatttcaatggaagaattccacat
atcccaaagatcgttgaactcgatcatttaaccattactggtaatgttaatttgggtaag
aatgttacattgaaaggtactgttattattgtttgttctgatggtcaaagcatcgatatt
cctaatggatccgtattggaaaatgtagtgattacaggtaatttacaaattttggaacat
tag

DBGET integrated database retrieval system