KEGG   Zygosaccharomyces rouxii: ZYRO0E07282gHelp
Entry
ZYRO0E07282g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K14569  
ribosome biogenesis protein BMS1
Organism
zro  Zygosaccharomyces rouxii
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    ZYRO0E07282g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:555489..559088
Genome map
AA seq 1199 aa AA seqDB search
MSTMEQSNKEHRQRKEKNTAKKKLHTQGHNAKAFAVAAPGKMARTMQRSSDVNERKLHVP
MVDRTPEDDPPPVIVAVVGPPGTGKTVLIRSLVRRLTKTALSELNGPITVVSGKRRRLTF
IECPADDLNAMMDLAKIADLVLMMIDGNFGFEMETMEFLNIAQQHGMPRVLGVVTHLDLF
KSQSTMRAAKKRLKHRFWTEVYQGAKLFYLSGVVNGRYPDREILNLSRFISVMKFRPLKW
RNEHPYMLADRITDLTHPEIIHSQGTKVDRKVALYGYLHGTALPADPGTKVHIAGVGDLS
IGQVEKLPDPCPTPYYQQKIDEYEREKLKSEGGTTGTTTRRRKRLDDKDKLIYAPMSDVG
GVLMDKDAVYIDVGKKNEGPSFVPGQEKGEGERLVTSLQSADKNYAERFDGVGLQLFSNG
TEYHAPEEGSSDEDADADESDKEVADSGRSSLRHAKTHGKSVQDVDREVDELPSDEDEED
MEEGSEDEMPKSRLEEIDFDRDLEGDGHSEKLAMESDSEFELSEPEGESWEVSTASKLKG
SQNRRRKWDIGKLIYMDNIPPRECLKRWRNEDVGDEEEEGSDIEQDEGEGFFKKNDGSFS
KAHDYEGDLERFSPYFDKIEKLMEKWSSLDSLKDRFIGVPKPEDSKEDGVSDEEGKDEEV
YGDFEDLEGQEEQPSESDGDEGEHDSEEDSEDNESQGGDPSENESEDSFADFEKEEQKDN
GGQNNNLSVEEERQQNMAKKEKLRFQFEMEEGDNFKEDDPENEYDTWYELQKAKIAKQLE
INNAELENMPVEQRHRFEGYKAGSYVRIVFENVPMEFIENFDSRVPIIMGGLLPTELKFG
IINARIRRHRWHRKILKTNDPLVLSLGWRRFQTLPVYTTTDSRTRNRMLKYTPEHTYCFA
SFYGPLCSPNTPFCGVQVVANSETGGGFRIAATGMVEEIDANVEIVKKLKLVGFPSKVFK
NTAFIKDMFSSAMEIARFEGAQIKTVSGIRGEIKRALSKPEGHFRATFEDKILMSDIVIL
RSWYPVHVKRFYNPVTSLLLKSKNEWKGMRLTGKIRADQGIETPANPDSNYQKVERVERK
FNGLKVPKAIQKDLPFKSQVHQMKPQKKKTYMAKRAVVLGGEEKKARTLMQQVYTLSRSK
DEKKKAKKQDERKERLKRLAKAEEEKVQRDKRKKKEYFTTQGKKRSGGETEGGSSKKRK
NT seq 3600 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgatggaacagtctaataaggagcatcgtcaaagaaaggagaagaatacggca
aagaagaagctgcatacgcagggtcataatgctaaggccttcgcagttgccgctcctggt
aagatggctaggaccatgcagaggtccagcgatgtgaatgagaggaaattgcacgtcccc
atggtagatcgtacacctgaagatgaccccccaccagttatcgtagccgttgtagggcct
cctggtactggtaaaactgttctaatcagatcgttagttaggagacttactaagaccgca
ttgagtgagctgaacggtcctatcacagttgtttccggtaaacgtagaaggctaacgttt
atagagtgtccagcggatgatttaaatgcgatgatggatttggctaagattgcagattta
gtattaatgatgatagacggtaattttgggtttgagatggaaacgatggaatttctgaat
atcgctcagcaacatggtatgcctcgtgtgcttggtgttgtaacccatttggatcttttc
aaatcgcagtctactatgagagctgctaagaaaagattaaagcatagattttggactgaa
gtttatcaaggtgctaaacttttctacttatcaggtgtggttaacggtaggtacccagac
cgtgaaatattgaatttgtccagatttatttcagttatgaaatttagacctttgaaatgg
aggaatgagcatccatatatgttagcagaccgtataacggatttaacccaccctgaaata
atccactctcaaggtacaaaagtggatcgtaaagttgcattatatggatatttgcatggt
acagccctgccggcagacccaggtactaaggttcacattgcaggtgtaggtgatttatca
atagggcaagtggagaaattgccagatccatgtcctacaccttactatcaacagaagatt
gatgaatacgaaagggagaaattgaaaagtgaaggtggtacaactggaactacaactaga
aggcgtaagagattggacgacaaggataagttgatttatgcccccatgtctgatgtaggc
ggtgtgttaatggataaagacgcagtctatattgatgtcggtaagaagaatgaaggccct
agttttgtaccaggtcaagagaaaggtgaaggtgaaaggctcgttacaagtctacaatca
gcggataaaaattacgcggagagattcgacggtgttggattacagcttttctcaaatggt
actgaataccatgcgccggaagagggttctagcgatgaagatgctgatgctgatgagtct
gacaaagaagttgcggacagcggtagatcatctttgagacatgctaagacacatggtaaa
tccgtccaagatgtagatagagaagtggacgaattaccaagtgatgaggatgaggaagat
atggaagaaggttcagaggatgaaatgccaaaatctagattggaagaaatcgatttcgat
cgtgatttagaaggtgatggacatagtgaaaaattggccatggaatcagattcggaattc
gagttaagtgaacctgaaggcgaaagctgggaagtttctaccgctagtaaactcaaggga
agtcagaatcgtcggaggaagtgggatattggtaaattgatctacatggataatattcca
ccaagagagtgtttaaaaagatggagaaatgaagatgtaggtgacgaagaagaagaagga
agcgatatcgaacaagacgaaggtgaaggtttcttcaagaagaacgatggttctttttcc
aaggcgcatgattatgaaggtgatctagaaaggttttctccatattttgacaagattgaa
aaattgatggaaaaatggtcctctctcgactctttgaaagatagattcattggtgtacct
aagccagaggactcaaaagaggatggagtttctgatgaagagggtaaagatgaagaagtc
tatggagattttgaagacttggaaggtcaagaagaacaaccatctgaaagtgatggagat
gaaggagaacatgacagtgaagaagacagcgaggacaatgagtctcagggtggagatcct
tcagaaaacgaaagcgaagattcatttgctgattttgaaaaggaagagcagaaagataat
ggaggtcaaaacaacaatctttccgttgaagaagagcgtcagcaaaatatggctaagaag
gagaagctgcgttttcaatttgaaatggaagaaggtgacaacttcaaagaggatgatcca
gagaatgaatatgacacctggtatgagcttcaaaaggctaaaattgctaagcaattagag
attaacaatgcggaattggagaacatgccagttgaacaacgtcacaggtttgaaggttat
aaggctggttcttacgttaggattgtattcgaaaatgtaccaatggaattcatcgagaat
ttcgattcgagagtccctatcatcatgggtggcttgctacctacggaattgaaatttggc
attattaacgccagaattagaagacaccgttggcacagaaagatcttaaaaactaatgat
ccattagtcttgtccctgggctggagaagattccaaactttacccgtttacacgacgacg
gactcgagaacaagaaatagaatgttaaagtatactccagaacatacttactgtttcgcc
agtttctatggacccctctgctctcctaatacacctttctgtggtgttcaagtggtcgcc
aacagtgaaactggaggtggttttagaatcgctgccactggtatggttgaggaaattgat
gccaatgtagaaattgtgaagaaattaaaacttgttggtttcccaagtaaagtattcaag
aatactgctttcatcaaggacatgttttccagtgccatggaaattgcccggttcgaaggt
gcccagatcaagaccgtctctggtattcgtggtgagatcaaaagggcactgtctaagcca
gaaggtcattttagagctactttcgaagataaaattctcatgagtgatattgtgatttta
agatcatggtatcccgttcatgttaagaggttttacaatccagtgacttcgttattattg
aaatcaaagaatgaatggaagggtatgagactcactggtaagattagagccgatcaagga
attgaaacaccagctaacccagatagtaattaccagaaagtggaacgtgtagagaggaaa
tttaatggtctcaaggtgcctaaggcaattcaaaaggacttacctttcaagtctcaagtt
catcaaatgaagccgcaaaagaagaaaacttacatggctaaaagagctgtggttctcggt
ggagaagaaaagaaggcacgtacattgatgcaacaggtttacacgctctcgagaagtaaa
gatgaaaagaagaaggccaagaaacaggatgaacgtaaggaaaggttgaaaagattggct
aaagctgaagaagaaaaagtccaaagagacaagaggaagaagaaagagtatttcacaact
caaggtaagaaaagatctggtggagaaactgaaggcggtagttcaaagaagaggaaataa

DBGET integrated database retrieval system