KEGG   Zygosaccharomyces rouxii: ZYRO0F00352gHelp
Entry
ZYRO0F00352g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:zro00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:zro04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(34415..36892)
Genome map
AA seq 825 aa AA seqDB search
MSRNLRSMFRRTSGFVTSTLKDTHSDGHSSLSIAYPCAFQDIIENIENTGSSSEVLSASC
DKMKRGLWMRRIGRKKQVEYLFKLESSGAIVWKDGGKRLPLDSIKDIRTGEMASNYREQY
GVSIKVSHLWVTVIYYVSNKLKALHVVANNQEELDVFMNCICGLVKLRMELMESISVPDN
EKFANIHWHSTVSRRKEDETKDTLTFDDVRKLCDRFHIYCSTNHLKKFFRMADVNNNGLL
NFQEFQTFVTLLKTRPELKQLWNSITLGRSAMSLQEFHQFLTQEQGEQASEQDAQAIIGR
FKKTKDGGFTYDDFIKYLGAQPHAVEMQEDYDRPLNQYFVASSHNTYLLGKQVGETPSVE
GYMQALQQGCRCIEIDIWDDDIGPVVCHGFLTPAIPLINVIEIIRKYAFITSPYPLIISL
ETNCNRENQAIAASIFMNSLGSMLYQNINEDGPLPSPNELRHKILLKAKKTKRVSDVFNP
DLQNGGTMSWEGASSSYSSSYESELENMIKLKETKSASSANPTTIRRIRRVNIRKGVEVS
EKLLTISAIYGLKFRNFSLPGSKTTTHCFSLNERKIDNLCNDRIQELSIDKHNRRHLMRV
YPHAFRYKSSNFNPIKFWRLGAQFVALNWQTNDLGQQINLAMFQLSNQKNGMLHSGYVLK
PLSLREPVPKLQDIPAHYDSFYQTPVQVHLKVLSAQLLPKPAETKNTKDELFAPFVEIEF
FSDEELLQPPTVFKGGTKPSSPNAISTEVCKENGFNPVWGTEIHLKLRHTDFTFVKFTVK
TGEFALALSCLKLDQLKRGYRHIPLYSQEGELYIFSTLFISTHIS
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaaatttgagatccatgttcagaagaacgtctggttttgttacttctactttg
aaagatacacattcagatggacactccagtttatcaattgcatatccttgtgcctttcag
gatataatagaaaatattgaaaatacgggttcgagctctgaagtcttatcagcttcttgt
gataaaatgaagagaggattatggatgagaagaataggaagaaaaaaacaagtggaatat
cttttcaaattggaaagcagtggtgctattgtatggaaagatgggggtaaaagattaccg
ttggattccatcaaagatattcgtactggagagatggcaagtaattatagagaacagtat
ggggtatccatcaaagtgtcacatctttgggttactgtcatatactacgtctctaataag
ttgaaggcgctacatgtggtagcaaataatcaagaggaacttgacgtttttatgaattgc
atatgtgggttagttaaattaagaatggaattaatggaaagtatatctgttcctgataat
gaaaaattcgctaacattcattggcatagtacggtctctcgaaggaaagaggatgaaact
aaagacaccctaacctttgatgatgtgagaaaattatgtgatagatttcacatttattgc
tctacgaatcatttaaagaaattttttcgcatggcagatgttaacaacaatggtcttttg
aacttccaggagttccaaacttttgtaacgctattaaagaccagacctgaactcaagcaa
ttatggaattctataacactaggacgttctgcaatgagtttacaggagtttcaccagttt
ttgacacaagaacagggtgaacaagcttctgaacaggatgcccaggctataattggcaga
ttcaaaaagacaaaggatggcggtttcacttatgacgattttatcaaatatttaggagcc
caacctcatgcagtggaaatgcaggaagattatgatagacccttaaaccagtattttgtg
gcgtcttctcataatacgtatctgttgggtaaacaggtgggcgaaacgccgtctgtggaa
ggttatatgcaggcgttacaacaaggctgccgatgtattgagattgacatctgggatgac
gacataggtccagttgtatgtcacggatttctcactccggcgatacctctaataaatgtt
atagaaatcattcgcaaatacgcatttattacatcaccatatcccttgatcatatctctg
gagaccaattgcaacagggaaaatcaagcaattgcagcgtccatattcatgaattcattg
ggctccatgttgtatcaaaacatcaatgaagatggcccattaccttcccccaatgaatta
agacacaagattcttttaaaggctaagaagacgaaaagagtgtctgacgttttcaaccca
gatttacaaaatgggggaactatgtcgtgggagggtgcttcctcatcttatagttcatct
tatgaatcggaattagaaaatatgataaaacttaaggaaaccaaatctgcatcaagcgcc
aacccaactactattcgcaggatacgaagagtgaacataagaaaaggtgtagaagtaagt
gaaaaacttttaaccatttcagccatttatggattgaaatttaggaatttttcgttacca
ggttccaagacaactacacactgtttttcattaaatgaaagaaagatagacaacctttgc
aatgatagaatccaagaattatccattgacaagcataacaggcgtcatttaatgcgtgtg
tatcctcatgcatttcggtacaaatcatctaactttaaccccataaaattttggagactg
ggcgctcaatttgtagctctcaattggcagactaatgacttgggccagcagattaattta
gccatgttccagttgtcaaaccagaaaaatggtatgttacattcaggatacgttcttaaa
ccactaagtttgagagaaccagtccctaaattacaagatataccagctcattatgattca
ttttatcaaacgcccgttcaggtccatctcaaggtgttatcggcacagttgcttccaaaa
cctgcagagaccaaaaatactaaggatgagctattcgcaccctttgttgagattgaattt
ttcagcgacgaagaactattacaaccaccaacggtattcaaaggtggtaccaaaccttca
tcgcctaatgcaatctccaccgaggtgtgcaaggaaaacggattcaaccccgtatgggga
acggagattcatttgaagttaagacatacagatttcacattcgttaaatttactgtcaaa
acaggagaattcgctttggccctgtcttgtcttaagcttgatcaactgaagaggggctat
agacacatcccactttacagccaagaaggtgaattgtatatattttctacgctatttatc
tctacacatatctcttga

DBGET integrated database retrieval system