KEGG   Zygosaccharomyces rouxii: ZYRO0F01254gHelp
Entry
ZYRO0F01254g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00280  Valine, leucine and isoleucine degradation
zro00410  beta-Alanine metabolism
zro00640  Propanoate metabolism
zro01100  Metabolic pathways
zro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ZYRO0F01254g
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ZYRO0F01254g
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ZYRO0F01254g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     ZYRO0F01254g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 8205005
NCBI-ProteinID: XP_002497252
UniProt: C5DX08
Position
F:101180..102673
Genome map
AA seq 497 aa AA seqDB search
MLRSIAKASCRRQFSASSMALNKPVLFNVQDTARVVSLNRPGKLNALNTEMCSLVFDTLK
EYSKSDSAHLVVVKSVNHPRSLCAGGDVAAVATLNKAGQYDQSIDFFQHEYSLNFQLATY
GKPIVAFMDGITMGGGVGVSVHNPFRVATEYTKLAMPEMDIGFFPDVASTFALPRLINLS
NENAQLALYLVLTGEVLTGEEAYLLGIASHYVPHENIEDLQNRLGELVARDGRFNDGSFY
DTVNEAIEEFSRPLPSGKQLLRYTVDQLRVIEACFDAYSLTSIQQLLHNLERVASDPSNS
EDARKFAQFTLQRLLTKSPTSMQVALRLIHENGRDNLENAVKRDLYTAANFALASQQGSA
LPVEFNEAVTHKLINKNKDPYSWKYKLGDLSPSQLTSLVSPKPSVPLSLLRNTRNITYKD
YPHHHRYQLPKEQQILEYAVGGGEQKPLTRRQVVEYFTNFYGPSKGKVGTDILVDLVLAK
NCQEDPVTGHLTSLNRS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgctaaggtctattgccaaggctagttgtaggcgccaattttcagcttcatcaatggct
ttaaacaaaccagttctctttaacgtgcaagatactgcgcgtgtcgttagtttgaatagg
cctggcaagctcaatgctctcaataccgaaatgtgttcattagtcttcgacactcttaag
gaatattccaagagtgatagcgcacatctagttgttgttaagtctgtgaatcatccaaga
tcgctttgtgcaggtggtgatgtagccgctgtagctactcttaataaagcaggtcaatac
gatcaatcaattgactttttccaacacgaatattctttaaatttccaattggcaacttat
ggtaaacctattgttgcatttatggatggtatcaccatgggtggtggtgttggtgtttct
gttcataatccattccgtgtagcaacagaatacacaaaattggcaatgccagagatggac
attggttttttccccgatgtcgcaagtacgtttgccctaccacgtttgatcaatttgtct
aatgaaaatgcacaattagctctttatttggttttaactggtgaagttttaacaggtgaa
gaagcttatttacttggtattgcatctcattacgttcctcatgaaaatattgaggattta
caaaatagattaggtgagttagttgcacgagatggccgtttcaatgatgggtccttttat
gatacagttaatgaggctatcgaagaattctcaaggcctttaccatctggtaaacagttg
ttgaggtacacagtagatcaactacgtgttatcgaagcttgtttcgacgcttacagtttg
acctcgattcaacagttgttacacaatttggaacgtgtagcttcagatccatcaaactct
gaagacgctagaaaatttgcacaattcactttacaacgtctattgactaaatcgccaact
tctatgcaagtggctttgagattaattcatgaaaatggtagagataacttggaaaatgct
gttaaaagagatttatacactgccgcaaacttcgctctagcttcacaacaaggttctgct
ttaccggtagaatttaatgaagccgtcacccataaattgatcaacaaaaataaggatcca
tattcttggaaatacaaactgggagacttatctccatctcaattgacatcactagtatcg
ccaaaaccttcagttccactttctctcctaagaaatacaagaaatattacttataaggat
tatccacatcatcacagataccagttgcccaaagaacaacaaattttagaatatgctgtt
ggtggaggtgaacaaaagccacttacgagacgccaagtcgttgaatatttcaccaatttt
tacggtccttcaaagggtaaggtcggtacagatattttagttgatctagtgttagctaaa
aactgtcaagaagatcctgttacgggtcatctaacctctctaaatagatcttga

DBGET integrated database retrieval system