KEGG   Zygosaccharomyces rouxii: ZYRO0F01254gHelp
Entry
ZYRO0F01254g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:zro01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:zro00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:zro00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:zro00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:101180..102673
Genome map
AA seq 497 aa AA seqDB search
MLRSIAKASCRRQFSASSMALNKPVLFNVQDTARVVSLNRPGKLNALNTEMCSLVFDTLK
EYSKSDSAHLVVVKSVNHPRSLCAGGDVAAVATLNKAGQYDQSIDFFQHEYSLNFQLATY
GKPIVAFMDGITMGGGVGVSVHNPFRVATEYTKLAMPEMDIGFFPDVASTFALPRLINLS
NENAQLALYLVLTGEVLTGEEAYLLGIASHYVPHENIEDLQNRLGELVARDGRFNDGSFY
DTVNEAIEEFSRPLPSGKQLLRYTVDQLRVIEACFDAYSLTSIQQLLHNLERVASDPSNS
EDARKFAQFTLQRLLTKSPTSMQVALRLIHENGRDNLENAVKRDLYTAANFALASQQGSA
LPVEFNEAVTHKLINKNKDPYSWKYKLGDLSPSQLTSLVSPKPSVPLSLLRNTRNITYKD
YPHHHRYQLPKEQQILEYAVGGGEQKPLTRRQVVEYFTNFYGPSKGKVGTDILVDLVLAK
NCQEDPVTGHLTSLNRS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgctaaggtctattgccaaggctagttgtaggcgccaattttcagcttcatcaatggct
ttaaacaaaccagttctctttaacgtgcaagatactgcgcgtgtcgttagtttgaatagg
cctggcaagctcaatgctctcaataccgaaatgtgttcattagtcttcgacactcttaag
gaatattccaagagtgatagcgcacatctagttgttgttaagtctgtgaatcatccaaga
tcgctttgtgcaggtggtgatgtagccgctgtagctactcttaataaagcaggtcaatac
gatcaatcaattgactttttccaacacgaatattctttaaatttccaattggcaacttat
ggtaaacctattgttgcatttatggatggtatcaccatgggtggtggtgttggtgtttct
gttcataatccattccgtgtagcaacagaatacacaaaattggcaatgccagagatggac
attggttttttccccgatgtcgcaagtacgtttgccctaccacgtttgatcaatttgtct
aatgaaaatgcacaattagctctttatttggttttaactggtgaagttttaacaggtgaa
gaagcttatttacttggtattgcatctcattacgttcctcatgaaaatattgaggattta
caaaatagattaggtgagttagttgcacgagatggccgtttcaatgatgggtccttttat
gatacagttaatgaggctatcgaagaattctcaaggcctttaccatctggtaaacagttg
ttgaggtacacagtagatcaactacgtgttatcgaagcttgtttcgacgcttacagtttg
acctcgattcaacagttgttacacaatttggaacgtgtagcttcagatccatcaaactct
gaagacgctagaaaatttgcacaattcactttacaacgtctattgactaaatcgccaact
tctatgcaagtggctttgagattaattcatgaaaatggtagagataacttggaaaatgct
gttaaaagagatttatacactgccgcaaacttcgctctagcttcacaacaaggttctgct
ttaccggtagaatttaatgaagccgtcacccataaattgatcaacaaaaataaggatcca
tattcttggaaatacaaactgggagacttatctccatctcaattgacatcactagtatcg
ccaaaaccttcagttccactttctctcctaagaaatacaagaaatattacttataaggat
tatccacatcatcacagataccagttgcccaaagaacaacaaattttagaatatgctgtt
ggtggaggtgaacaaaagccacttacgagacgccaagtcgttgaatatttcaccaatttt
tacggtccttcaaagggtaaggtcggtacagatattttagttgatctagtgttagctaaa
aactgtcaagaagatcctgttacgggtcatctaacctctctaaatagatcttga

DBGET integrated database retrieval system