KEGG   Zygosaccharomyces rouxii: ZYRO0F04378gHelp
Entry
ZYRO0F04378g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ZYRO0F04378g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:371432..372604
Genome map
AA seq 390 aa AA seqDB search
MSVLDFKPEIWTCSANEALKISLVSENAIQFPPAFTYPIYGDAEQIFGYKDLIIHLVFDS
VTFKPFVNVKYSDKLKDDAEDVERKLLNFLPKGDVITKDEAKWVDAFHEEQQSFSLPSDE
FKVSEYENEGTQFVVYKQSIKEDFTKKLHRRVQIFTLLFIEAASYIDETDDNWEIYWVFN
NDTKQCIGFVTTYKYWKYLGAAQFDDSEDIKFRAKISQFLIFPPYQHKGHGSLLYKTLVD
SWHQNDDILEITVEDPNESFDDLRDRNDLERLYKEKFFDLVPEQGEISEQWIEAERRKYK
LEKRQFHRLIEMILAYKNSENYRLQVKKRLYTKNFDALYDMGEDDRKDALQKSFILLSDD
YKRIISSCSFLKHGLESPSDGQDTKKPKRV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtattggattttaagcctgaaatttggacctgctcggcaaatgaagctttgaaa
atctcactggtgagtgagaatgccattcagttcccaccggcatttacatatcccatctat
ggtgacgctgaacaaatatttggttataaagatttgattattcatttggtttttgactca
gtgacgttcaaaccatttgtcaatgtcaagtattcagataaattgaaagatgatgcagag
gatgtagagcgcaaactattgaacttccttcctaagggagatgtaataacaaaagacgag
gccaaatgggtggatgcttttcatgaggagcaacagagtttttctttaccctcagacgag
ttcaaggtatcagagtatgaaaatgaaggaacccaatttgtcgtatacaagcaaagcata
aaagaagattttactaagaagttacatcgccgagtacaaatctttacacttttgttcatc
gaggcagcttcttatattgatgaaactgatgataactgggaaatttattgggttttcaat
aacgacacaaaacaatgcataggtttcgtcactacctataaatattggaaatatttagga
gccgctcagtttgatgattccgaagatattaaattcagggctaagatatcccaattcctc
atttttccaccttaccaacacaaaggccacggatcattactgtacaagactttagtagac
tcttggcatcaaaacgatgatattttagagattacagtggaagacccaaatgaaagcttt
gatgatttaagagatcgcaatgatctggaaagattgtataaggaaaaattttttgatcta
gtcccagaacaaggtgaaatatcagaacaatggattgaggccgaacgtagaaagtataaa
ttggagaaaagacaatttcatcgtctgattgaaatgatactggcatacaaaaattcagaa
aactaccggttgcaggtcaaaaagcggttatatactaaaaattttgacgcactatatgac
atgggggaagatgatcggaaagacgccttgcagaaatctttcatacttctttctgacgac
tacaagcgtataatatcctcatgcagtttcttgaaacacggtttagaatcaccctctgac
gggcaagacaccaagaagccgaagagagtttaa

DBGET integrated database retrieval system