KEGG   Zygosaccharomyces rouxii: ZYRO0F04708gHelp
Entry
ZYRO0F04708g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZYRO0F04708g
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ZYRO0F04708g
Enzymes [BR:zro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ZYRO0F04708g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:394053..395756
Genome map
AA seq 567 aa AA seqDB search
MINHVTIKGTMYNGTRSLSSSTSNSSSVLNLKSFVAEEVRKIEDWWGQPRYKDVERPYSS
LDVVKHRGSLPVECNRYASSFQAQKLFRLLEDKFEKKLPLHTLGVIDPVQMTQLARSKEI
EVAYLSGWACSSTLVGSTNEVSPDFGDYPYNTVPNQVERIFKAQQMHDRKLFLEKVEGLT
NDDTTDYLKPIIADADMGHGGNTTVMKLAKLFAEKGAAAIHLEDQMVGGKRCGHLGGAVI
VPSSTQLSRLIATRLQWDIMGTENLILARTDSCNGELLSSSSDPRDHKFIKGTIEPGITP
WSDRLAGLESQPMVTSDQIAIEEAEWYDKHHVFTFDEALQKQVSQTEYERYLELKNKHLK
EKPFVSLKEMKALASQASPATTIEFDWDAPRTKEGYYLYNGGMEAAIERSLYFAPYADMI
WLETKTPDLKQAISFSSRIHEVYPHVKLVYNLSPSFNWSAHGYTEENLKGFIWDLAKHGF
VLQLVSLAGLHVNGLSFWQLVKSFGQNGMKAYVEQVQRLEKLENSDVLTHQKWSGAEYVD
SIIKVLQNGSSSQTLSTSGDSFTENQF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcacgttacaattaagggaacaatgtataatggaacgagaagtcttagtagc
agtacttcgaattcatcatcagttttgaacctaaaaagtttcgtcgcagaggaagttcga
aaaattgaagattggtgggggcaaccgcgatacaaggatgtggaaagaccctattcgtca
cttgatgtcgtcaaacacaggggaagtttaccagtggaatgcaatcgttatgcctcttct
ttccaagctcaaaaattgttcagattgttagaggataaatttgagaagaaactccccctc
cacactcttggtgttatcgatcctgtgcagatgactcaattagcaagatccaaggagatt
gaggtggcctacttatctggttgggcatgttcttctactttagtgggctccactaacgaa
gtttctcccgattttggagattacccatacaatactgtacctaatcaggttgaaagaatc
tttaaagctcagcaaatgcacgataggaaactttttttggagaaagttgaaggattaacc
aatgacgacactactgattatctaaagccaataatcgcagatgctgatatgggacatggt
gggaataccacagttatgaaattggccaaattgtttgccgagaaaggtgcggccgccata
cacttagaggatcagatggtaggcggcaaaaggtgcggtcatctagggggtgcagtgata
gttccctcttcaacccaattgtcacgattaatagcaaccaggctccaatgggatattatg
ggtacggagaacctcatcctagcaagaactgattcgtgtaatggagaactattgagtagc
agtagtgaccctcgcgatcacaaatttataaagggaaccattgaaccaggaatcacacct
tggagtgacagattagcaggattagaaagtcaacctatggtaactagtgaccaaattgcc
attgaagaagcggaatggtacgacaagcatcatgtgtttacctttgacgaagcactacaa
aagcaagtgtctcagaccgaatatgaaaggtatctggaattaaagaataaacacctcaaa
gaaaagccatttgtaagtttgaaagaaatgaaagcattggcttctcaagcttcccccgct
actaccatagaatttgactgggatgcgcccaggaccaaagagggatactacctttacaat
ggcggtatggaggctgccattgaaagatcattatactttgcaccttatgctgacatgatc
tggcttgagacgaaaactccagatttaaagcaggcaatttcattttcctcaagaatccac
gaagtttatccacatgttaaattagtttacaacctgtcgcccagtttcaattggagtgca
cacggctatacagaagaaaacttgaagggttttatttgggaccttgctaaacacggattt
gtcctacaactagtttcattagcagggctacatgttaatggcttgtcattctggcaactt
gtcaagagttttggtcagaatggtatgaaagcgtacgtcgagcaagtacagcgtctggag
aagctcgaaaatagtgacgttctcacacaccagaaatggtctggtgcagaatacgttgat
tccataattaaagttttacagaacggatcctcatcacaaactctaagcacatccggagac
tccttcacggagaatcagttctga

DBGET integrated database retrieval system