KEGG   Zygosaccharomyces rouxii: ZYRO0F04708gHelp
Entry
ZYRO0F04708g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00630  Glyoxylate and dicarboxylate metabolism
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
zro01200  Carbon metabolism
Module
zro_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ZYRO0F04708g
Enzymes [BR:zro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ZYRO0F04708g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 8205161
NCBI-ProteinID: XP_002497402
UniProt: C5DXF8
Position
F:394053..395756
Genome map
AA seq 567 aa AA seqDB search
MINHVTIKGTMYNGTRSLSSSTSNSSSVLNLKSFVAEEVRKIEDWWGQPRYKDVERPYSS
LDVVKHRGSLPVECNRYASSFQAQKLFRLLEDKFEKKLPLHTLGVIDPVQMTQLARSKEI
EVAYLSGWACSSTLVGSTNEVSPDFGDYPYNTVPNQVERIFKAQQMHDRKLFLEKVEGLT
NDDTTDYLKPIIADADMGHGGNTTVMKLAKLFAEKGAAAIHLEDQMVGGKRCGHLGGAVI
VPSSTQLSRLIATRLQWDIMGTENLILARTDSCNGELLSSSSDPRDHKFIKGTIEPGITP
WSDRLAGLESQPMVTSDQIAIEEAEWYDKHHVFTFDEALQKQVSQTEYERYLELKNKHLK
EKPFVSLKEMKALASQASPATTIEFDWDAPRTKEGYYLYNGGMEAAIERSLYFAPYADMI
WLETKTPDLKQAISFSSRIHEVYPHVKLVYNLSPSFNWSAHGYTEENLKGFIWDLAKHGF
VLQLVSLAGLHVNGLSFWQLVKSFGQNGMKAYVEQVQRLEKLENSDVLTHQKWSGAEYVD
SIIKVLQNGSSSQTLSTSGDSFTENQF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcacgttacaattaagggaacaatgtataatggaacgagaagtcttagtagc
agtacttcgaattcatcatcagttttgaacctaaaaagtttcgtcgcagaggaagttcga
aaaattgaagattggtgggggcaaccgcgatacaaggatgtggaaagaccctattcgtca
cttgatgtcgtcaaacacaggggaagtttaccagtggaatgcaatcgttatgcctcttct
ttccaagctcaaaaattgttcagattgttagaggataaatttgagaagaaactccccctc
cacactcttggtgttatcgatcctgtgcagatgactcaattagcaagatccaaggagatt
gaggtggcctacttatctggttgggcatgttcttctactttagtgggctccactaacgaa
gtttctcccgattttggagattacccatacaatactgtacctaatcaggttgaaagaatc
tttaaagctcagcaaatgcacgataggaaactttttttggagaaagttgaaggattaacc
aatgacgacactactgattatctaaagccaataatcgcagatgctgatatgggacatggt
gggaataccacagttatgaaattggccaaattgtttgccgagaaaggtgcggccgccata
cacttagaggatcagatggtaggcggcaaaaggtgcggtcatctagggggtgcagtgata
gttccctcttcaacccaattgtcacgattaatagcaaccaggctccaatgggatattatg
ggtacggagaacctcatcctagcaagaactgattcgtgtaatggagaactattgagtagc
agtagtgaccctcgcgatcacaaatttataaagggaaccattgaaccaggaatcacacct
tggagtgacagattagcaggattagaaagtcaacctatggtaactagtgaccaaattgcc
attgaagaagcggaatggtacgacaagcatcatgtgtttacctttgacgaagcactacaa
aagcaagtgtctcagaccgaatatgaaaggtatctggaattaaagaataaacacctcaaa
gaaaagccatttgtaagtttgaaagaaatgaaagcattggcttctcaagcttcccccgct
actaccatagaatttgactgggatgcgcccaggaccaaagagggatactacctttacaat
ggcggtatggaggctgccattgaaagatcattatactttgcaccttatgctgacatgatc
tggcttgagacgaaaactccagatttaaagcaggcaatttcattttcctcaagaatccac
gaagtttatccacatgttaaattagtttacaacctgtcgcccagtttcaattggagtgca
cacggctatacagaagaaaacttgaagggttttatttgggaccttgctaaacacggattt
gtcctacaactagtttcattagcagggctacatgttaatggcttgtcattctggcaactt
gtcaagagttttggtcagaatggtatgaaagcgtacgtcgagcaagtacagcgtctggag
aagctcgaaaatagtgacgttctcacacaccagaaatggtctggtgcagaatacgttgat
tccataattaaagttttacagaacggatcctcatcacaaactctaagcacatccggagac
tccttcacggagaatcagttctga

DBGET integrated database retrieval system