KEGG   Zygosaccharomyces rouxii: ZYRO0F05258gHelp
Entry
ZYRO0F05258g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
zro  Zygosaccharomyces rouxii
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:zro00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:439058..439393
Genome map
AA seq 111 aa AA seqDB search
MPAPYQKGSAKKGATLFKTRCLQCHTVENGGPHKVGPNLHGVFGRHSGQAPGYSYTDANI
KKGVVWEEQSMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLVTYLKSATSK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccataccaaaagggttctgctaagaagggtgctactcttttcaagaccaga
tgtttgcaatgtcacaccgttgaaaatggtggtcctcacaaggtcggtccaaacttgcac
ggtgtcttcggtcgtcactccggtcaagccccaggttactcttacaccgatgctaacatc
aagaagggtgtcgtttgggaagaacaatctatgtctgactacctagaaaatccaaagaag
tacattccaggtaccaagatggccttcggtggtttgaagaaggaaaaggacagaaacgac
ttggtcacctacttgaagtctgccaccagcaaataa

DBGET integrated database retrieval system