KEGG   Zygosaccharomyces rouxii: ZYRO0F06798gHelp
Entry
ZYRO0F06798g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
zro  Zygosaccharomyces rouxii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:zro00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    ZYRO0F06798g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     ZYRO0F06798g
Protein kinases [BR:zro01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   ZYRO0F06798g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:558198..559676
Genome map
AA seq 492 aa AA seqDB search
MASLFKPPESARRNAKSPKLTLPPSLRNNHAELNHDDIINGAGIARPSNGSSPSLDHLRG
VTPLYSSSEITIPRSDQTPPTTSSSSIYSMTSSKPMKKRPVPPPIPTSVLSNLKESSSSQ
STPKVDKMANSLSKLQIGGDSTLPYSSQDLNNSTDTYPSAVLSAYDSNGNSPTALETKIA
GKDIDQLDEEVWEHQMLKHQIETVGILGEGAGGAVAKCRLKTNSGGKIFALKTINTLNTD
PEYQKQIFRELQFNKSFESDYIVKYYGMFADQQNSTIYIAMEYMGGKSLDAVYKNLIRRG
GRISEKVLGKIAEAVLRGLSYLHERKIIHRDIKPQNILLNLQGQVKLCDFGVSGEAVNSL
ATTFTGTSFYMAPERIKGQPYSVTCDVWSLGLTLLEVAQGRFPFGSDKMAANVAPIELLT
IILTFTPELKDEPELDIYWSKAFKSFIEYCLKKETRERPSPRQMINHPWIQGQMKKKTNM
EKFINKCWEDEA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgttattcaaaccacctgaatcagcaaggcgtaatgcaaaatctccaaagctt
acactcccgccttcgctgagaaataatcacgctgaattgaatcatgacgatattatcaac
ggtgcaggcatcgctagaccaagtaatggaagttcaccatcactcgatcatctacgagga
gtaacacctctatactcgtcatcggagatcactatacctcgttccgatcaaaccccacca
acgacatcatcatcatcaatatattctatgacatcatcaaaaccaatgaagaaaaggcca
gtaccaccaccaattcctacatctgtactctccaatttaaaagagtcatcttcatcacaa
tcgactccaaaagtggataaaatggcaaattcgttatccaagttacaaattggaggggac
tcgacgttgccttattcgagccaagacttgaacaattcgacagacacttaccctagtgca
gtattatccgcctatgacagtaatggtaatagtcctacggcattagagacaaaaattgca
ggtaaagatattgatcaattggatgaagaagtttgggaacatcaaatgttaaaacatcaa
atagaaacagtgggtatattaggtgaaggtgcaggtggtgctgttgccaaatgcagactt
aagacgaacagtggtggtaaaatatttgccctaaagacgataaacactctgaacacagat
cccgaataccaaaaacaaatattcagagagttacaattcaacaaatcgtttgaatctgat
tacattgtcaaatattatggtatgtttgcagatcaacaaaattccacgatatacattgcc
atggaatatatgggtgggaaatctttggacgcagtatacaaaaatttgattagacgtgga
ggtagaatcagtgaaaaagtattgggtaaaatagctgaagcggtattaagaggattatca
tatctacatgaacgtaaaattattcacagagacattaaacctcaaaatattttgctgaat
ttacaaggtcaagttaaattatgtgattttggtgttagtggtgaagctgttaattcatta
gctacaacattcactggtacatctttttatatggctcctgaacgtattaagggtcaaccc
tatagtgttacatgtgacgtttggtcattaggtctgacacttctagaagtcgcccaggga
cgttttccctttggatccgataagatggccgctaatgtggcccccattgaattattaaca
ataattttaacgtttacaccagaattaaaggatgaaccggaattagacatttattggagt
aaagcctttaaatcctttatcgaatactgtttgaagaaggaaactcgtgaaagaccatcg
ccaagacaaatgattaaccatccatggattcagggacaaatgaagaaaaagacaaatatg
gaaaaatttataaacaagtgctgggaagatgaagcttga

DBGET integrated database retrieval system