KEGG   Zygosaccharomyces rouxii: ZYRO0F06930gHelp
Entry
ZYRO0F06930g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
zro  Zygosaccharomyces rouxii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZYRO0F06930g
   00670 One carbon pool by folate
    ZYRO0F06930g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ZYRO0F06930g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:565878..566495
Genome map
AA seq 205 aa AA seqDB search
MGKPIVCIVAALCPHMGIGYRGGLPWKLSQEMKYFRQVTTSTFTEGKSNAVIMGRRTWES
IPAKFRPLKGRINVVLSRQFPSFQREDDRFLSNDLSHAIKSLQDLPVERIYIIGGAQLYT
ESIDIATHWLVTNIHFNSQNEQPPPVDTFLPRLTHHEEVSPEQLAEFLPSQVELPPLQAL
QYGNHHYSMQDNFTYWYTLYESQNT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaacccatagtatgcatagtggcagctctttgccctcacatgggcattggatat
cgaggcggattaccatggaaacttagccaagagatgaaatacttcagacaagttacgact
tcgacttttacagagggtaaatcaaatgccgttatcatgggaagacgtacgtgggaatcg
attccagcaaaattcagacctttgaaaggcagaatcaacgtggttctttcgaggcaattc
cccagtttccaaagggaggacgacagatttctaagtaatgacttatcccatgccattaaa
tcgctacaagatttacccgtcgagcgtatttacatcattggcggcgctcaattatacacg
gaaagcattgacattgcaacccattggctagtgacaaacatccatttcaactcacaaaac
gaacaacctccaccagtagacacttttcttccgagacttacccaccacgaagaggtgtca
cctgaacaactggcggagttcctgccaagccaggtggaactgccgccattgcaggcccta
cagtacggtaaccaccactacagcatgcaggataacttcacatactggtataccctatac
gagagccagaatacgtaa

DBGET integrated database retrieval system