KEGG   Zygosaccharomyces rouxii: ZYRO0F08514gHelp
Entry
ZYRO0F08514g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZYRO0F08514g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ZYRO0F08514g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZYRO0F08514g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(685717..687333)
Genome map
AA seq 538 aa AA seqDB search
MAKVFQRGHRYNKARQFMRFVIPTLILLLAGFNLVTSSDKGLESFFGGKHSGKRNVIFFV
TDGMGPTSLSLTRSFRQYVHELAYNDVLVLDQHLIGSSRTRASDSLVTDSAAGATAFACA
LKSYNGAIGVDSDKVPCGTILEGAKLAGYHTGLVVTTRITDATPGAFSAHVDFRSQEDLI
AEQQLGEYPLGRQVDLMIGGGRTHFYSSNSDPKYGDRGSRKDGKNLISKAEKDGWQYVGN
REQFDQLQLGQNVSLPLLALLADHDIPFDLDRKDEEYPSLEEETITAINALNEATKDSDK
GFFLLVEGSRIDHAGHQNDPSAQVREVLAFDRAFQAAKKLADKSQVETILISTSDHETGG
LAASRQITKSYPDYVWYPEVLSNAQHSGEYCSKQIEGYKGDDKKSFVQHEVLEKMLEIHD
YTDSDVDYLINEKDRNSIQDKLNDMISFRAEIGWSTHGHSAVDVNIYAYSNRKKALDEIK
DYLQGNHENTEIGDYMARYLNIDLAQVTKEIRDTKHSPGKKFTAKVFDEYGHKVGGLE
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggtttttcagagggggcatagatacaataaagcccgtcaattcatgagattt
gttataccaacccttatcttgttgttagcagggttcaaccttgtaacatcaagtgataag
ggtttggaatcgttctttggtggtaagcattctggcaagagaaatgttattttctttgtt
actgatggtatgggccccacatcattatcattaacgagatcctttagacaatacgttcac
gaattggcttataacgatgttctagtgttagatcaacatctaattggttcttcgagaaca
agagcttctgattcactagtgactgattctgctgctggagcaactgcatttgcttgtgca
ttgaaatcttataacggtgccattggagtcgattctgataaggttccatgtggcactata
ttagaaggtgctaaattagccggttatcataccggattagtggtaactacaagaatcaca
gatgctacaccaggtgcctttagtgcacatgtcgattttagaagccaagaggacttaatt
gccgaacaacaattgggcgaatatccattgggcaggcaggtagatctaatgatcggtggc
ggacgtacccatttctattcaagtaacagtgatcctaagtatggcgataggggtagtcgt
aaagatggtaagaatttaatttctaaagctgaaaaagatggttggcaatatgttggtaat
cgtgaacaattcgatcaattgcaattgggtcaaaacgtctcattaccactattagccttg
ttagcggaccatgacattccattcgacctagaccgtaaagacgaagaatacccatctttg
gaagaagaaaccattaccgctattaatgcattgaacgaagctaccaaggattctgataaa
ggatttttcctactagtagaaggctcaaggattgatcatgctggtcatcagaacgatccc
tctgcacaagttagagaagtgctagcctttgaccgtgcattccaagctgctaaaaaatta
gcagacaaaagtcaagtggaaaccattttaatttcaacatctgatcatgagactggtgga
ttagctgcctctagacaaattactaaatcatacccggattacgtttggtatccagaagtt
ctttccaatgcacaacactctggtgaatactgttccaaacaaattgaaggctacaaggga
gatgacaaaaaatcgtttgtccaacatgaagtgttagagaaaatgcttgaaattcatgat
tataccgatagtgatgttgattatttaattaacgaaaaagatagaaattctatccaagat
aaattaaacgatatgatttcatttagagctgaaattggctggtcaacccatggacatagt
gcagttgatgttaacatctatgcctacagcaaccgtaagaaggctctagatgaaattaaa
gattatttacaggggaaccatgaaaatacagaaatcggtgattatatggctcgctatttg
aacattgaccttgctcaagtgactaaagaaattcgtgatactaaacattctccaggtaaa
aaatttactgcgaaagtattcgatgagtacggacacaaggtcggcggtttggaataa

DBGET integrated database retrieval system