KEGG   Zygosaccharomyces rouxii: ZYRO0F09790gHelp
Entry
ZYRO0F09790g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01267  aspartyl aminopeptidase [EC:3.4.11.21]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.21  aspartyl aminopeptidase
     ZYRO0F09790g
Peptidases [BR:zro01002]
 Metallo Peptidases
  Family M18
   ZYRO0F09790g
Membrane trafficking [BR:zro04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    ZYRO0F09790g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M18 Peptidase_M42
Motif
Other DBs
NCBI-GeneID: 8205387
NCBI-ProteinID: XP_002497623
UniProt: C5DY29
Position
F:795479..796963
Genome map
AA seq 494 aa AA seqDB search
MFRVTLRKLSTMSSIATSSKTNYPKEFIKFLNESHTPYHVVHNMKLHLDQHGFQELSERE
AWNGKVQRKGRYYVTRNNSSIVAFAVGGKWQPGNAIAITGAHTDSPVLRIKPVSKRKTEN
YEQVGVECYGGGIWHSWFDSDLSIAGRVFVNDRESGKIVSKLVDLNKPLLKIPTLAIHLD
REVNSKFEFNKESQLLPIAGLVNGESKGDEDVKEDSFSSLKAVVERHHRSILELVAQQLN
LSSVSDIEDFELILYDYAAATLGGFHDEFVFSGRLDNLTSCFTSLHALTLAADTNIDEET
GIRLMSCFDHEEIGSSSAQGADSNFLPNVLERLASLKGDPSSDVNDPLSKSYILETFAKS
FFMSSDVAHAVHPNYVNKYESQHKPIIGGGPVIKINANQRYMTNSPGMVLVKKLADKAQV
PLQLFVVSNCSSCGSTIGPILASKTGVRTLDLGNPILSMHSIRETGGSEDLGLQIKLFKE
FFEQYSSLESNIIV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtttagagttactctaaggaaactttctacaatgtccagtattgcaacgtcttctaaa
actaactacccaaaagaattcattaaattcctcaatgaatctcatacaccttaccatgta
gttcacaacatgaaattacatctagatcagcatggttttcaagagttgagtgaacgtgaa
gcttggaatggtaaagtacaacgtaagggcagatactacgtgactaggaacaattcttca
attgtagcatttgctgttggtggaaaatggcaaccaggaaatgcaattgccattactggt
gctcatactgattctcccgtgcttagaatcaaaccagtatccaagagaaaaactgagaat
tacgaacaagttggtgtggaatgttatggtggtggtatttggcattcttggtttgattct
gatctgtccattgcaggtagagtttttgtgaatgatagagaatctggtaaaattgtctcc
aagttagtagatttgaataagccattgcttaaaatccctacgctggccattcatttggat
agagaagttaattcaaagtttgaatttaacaaggaatcgcaactattaccaattgctggg
ttggttaacggagagtccaagggagacgaggatgtcaaggaagattcgttttcatctttg
aaagcagttgtggaaaggcatcatcgtagcattttagaattggttgctcaacagttgaat
ctttcgtccgttagcgatatcgaagattttgaattgatcctttatgactacgcagcagcc
acgcttggtggtttccatgatgaatttgttttttcaggtagattggacaacttgacttca
tgcttcacgtctttacatgcattgactttagctgctgataccaatattgatgaagaaact
ggtattagactcatgtcatgctttgatcatgaagagattggatcctcttcagcccaaggt
gctgattccaacttcttacctaatgtacttgaaaggttggcatcattgaaaggtgatcct
tcttctgatgtgaatgatccattgtctaagtcctacattttagaaacttttgccaaatct
ttcttcatgtcctcggatgttgcccatgcagtacatccaaattatgtgaacaaatatgaa
tctcaacataaaccaattatcggcggcggtcccgttataaagatcaatgccaatcaacgt
tacatgactaattcaccgggaatggttctcgttaaaaaattggcagacaaagctcaagtt
ccattacaattatttgttgtgagtaattgttcctcttgtggatccactattggtccaatt
ttggcatcgaagacaggtgttaggacgttggatttaggtaatccgattttaagcatgcat
tccatcagggagactggtggctctgaagatttaggactacagattaaattatttaaagag
tttttcgaacagtatagttctttggaatcaaacattatagtttga

DBGET integrated database retrieval system