KEGG   Zygosaccharomyces rouxii: ZYRO0F10142gHelp
Entry
ZYRO0F10142g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
zro  Zygosaccharomyces rouxii
Brite
Exosome [BR:zro04147]
 Exosomal proteins
  Proteins found in most exosomes
   ZYRO0F10142g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(join(820724..821091,821172..821184))
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG
LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY
LIGAQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacaccgaaaacctattgggcacaggcaaaatagacaaggccgct
atctactcaagagccggcgattccttgtgggcctcatctggtgggttaacatttgcacca
caagaaattggtaagattgccgcaggtttcgacgaaccatcaggtttgcaaagtacaggt
ttattcgtacaaggccaaaaattcatgcttttgagagctgatgatcgttctatctatgca
agacatgatgctgaaggtatgtgttgcgttcgtaccaagcaaactattatcttagctcat
tacccaccaagtgtgcaagctggtgaagccaccaagattgtggaacagttggctgattac
ttgattggtgctcaatactga

DBGET integrated database retrieval system