KEGG   Zygosaccharomyces rouxii: ZYRO0F10472gHelp
Entry
ZYRO0F10472g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ZYRO0F10472g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     ZYRO0F10472g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:850603..852408
Genome map
AA seq 601 aa AA seqDB search
MQETMPESRSSRSEVRLNPFSIGSPHPYSHSRTRSRSHSRSSSRNRPSLTGPRPSQRLIR
TISVDSDVSIGEDEFTLKTGESHVPPEVPEEDSKEIADQLEGLKLSERSSFRESENVEVP
YVPTVLDNSLPMDYLQDDVLNTIQNLRIPKWYVRGSMGVSPLDRNKIKMTKITGAMTNVI
YKVEYPGLPSLLLRVYGPNIDTIIDREYELQVLARLSRRNIGPSLYGCFQNGRFEQFLEN
ATTLGKDDIRNWKTSQRIARRMKELHTGVPLMKSEREQGPVCWIKIEKWLENIEQRGEQW
VNDVSNVQKWLMCRDWPTFKKAVLRYRDWLYSRGLPYVRQGLVFCHNDTQYGNLLLSSPV
IPLDNVDPVISNPKSASSSSTVSSLFPQSSNVSLEQILNPPIQEQSQDSKLVVIDFEYAG
ANPAAYDLANHFSEWMYDYNSAEPYKCFASQFPTREQMLNFLYCYVSHLRNKNAVPIDDE
VRYYYNAIIKWRATAQLFWSLWGVLQSGKLDAPSAQLNDEKERPSGGKYIFTEMDEPSDA
LETPEATSESSSEKGVDIDSFDYLSYSRHKIELFWGDLLQMGVVERDDCVGIEEQLEATL
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaacaatgcccgaaagcagatcatctagaagtgaagttagacttaaccccttt
tctattggtagccctcacccttattcgcattctcggacaaggtcgaggtcacattctagg
tcttctagtaggaatagaccttctctgacgggtcctcggccttctcagagattgattcgc
accatcagtgtagattctgatgtttctataggagaagacgagtttacattaaagaccgga
gagtctcatgtcccaccggaggtgccagaggaagattctaaggaaattgctgatcaattg
gaaggtcttaaactaagtgagaggagctcattccgtgagagtgaaaatgtagaagttcca
tatgtgcccaccgtactagataattcacttccaatggattatttacaagatgacgttcta
aatacgattcaaaatttaaggattcctaaatggtacgttagaggatcaatgggggtttca
ccactggacagaaataagatcaagatgaccaagatcacaggcgcgatgaccaatgtgata
tataaggtcgaataccctgggttaccatcgctcttattgcgagtatacggacctaacata
gacaccattatagatagggaatatgagctacaagtgttggcaagattatcaagacgaaat
atcggaccttcattatatggatgtttccagaacggtagatttgaacagtttttggaaaat
gcaaccacactaggcaaagacgatattagaaattggaaaacttcgcaaagaattgcacgt
agaatgaaagaattacacacgggtgtaccgctgatgaaatctgaaagagaacagggacca
gtctgttggattaaaattgagaaatggttagaaaacatagagcaaagaggagaacaatgg
gtcaacgacgtttctaacgtacagaaatggttgatgtgtcgtgattggcccactttcaaa
aaagcagttctgcggtatagggattggctatattccagagggttgccatacgtgagacag
ggccttgttttctgtcacaacgatactcaatatggtaacctgttgctttcatcacctgtg
attccattagacaatgtggatcctgtgatttcaaatcccaaaagtgcgtcatcgtcatca
acagtttcttcacttttccctcaaagttcaaacgtttccctagaacaaatactcaatcca
ccgatccaagaacagtctcaagattccaaattggtagtcattgatttcgaatatgccggt
gccaatcctgccgcttatgatttagctaatcattttagtgagtggatgtacgattacaat
tctgcagaaccatataaatgctttgcgtcccagtttcccactagagaacaaatgttaaat
tttctttactgttatgtgtctcatttgagaaataagaatgccgtccccatcgatgatgaa
gtcaggtattattacaacgctatcattaaatggagagctacagctcaattgttctggtca
ctttggggggttttgcaaagtggtaaattggatgcaccatctgcacagctcaacgatgaa
aaagaaagaccaagtgggggtaagtatatttttactgagatggatgaaccatcggatgct
ctagagacgcccgaggcaaccagtgaatcgagctcagagaaaggtgtcgatatcgactcc
tttgattatctgtcttattcaagacataaaattgaactgttttggggggatcttttgcaa
atgggagttgttgaaagggatgattgcgttggtattgaagaacaattggaagctactcta
ttgtaa

DBGET integrated database retrieval system