KEGG   Zygosaccharomyces rouxii: ZYRO0F10494gHelp
Entry
ZYRO0F10494g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZYRO0F10494g
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZYRO0F10494g
  Amino acid metabolism
   00310 Lysine degradation
    ZYRO0F10494g
Enzymes [BR:zro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ZYRO0F10494g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(852619..853944)
Genome map
AA seq 441 aa AA seqDB search
MLSRSIRTSASRAIKSSQCMRTVSCASAKRYASSSLFTRQSAPSRIPQNLNSQFISRSLL
QRRLESTKVEVPPMAESLTEGTLSQYTKQVGESIQQDELLATIETDKIDIEVNAPVSGKI
VKLSFKPEDTVTVGQELAQIEEGEVSTGGEAPKEEPKPEEPKKEEPAAAAPPPPKPEAPK
KEAPKPAAPKKEAPKKPEPAPQAPKTTSFSRNEERIKMNRMRLRIAERLKESQNTAASLT
TFNEVDMSALLEMRKLYKDEIIKSKGVKFGFMGLFSKASTLAAKDIPSVNGAIEGDQIVY
RDYSDISIAVATPKGLVTPVIRNAESLSVLEVEQEIVRLSQKARDGKLTLEDMSGGTFTI
SNGGVFGSLYGTPIINTPQTAVLGLHGVKERPVTVNGKIESRPMMYLALTYDHRLMDGRE
AVTFLRTVKELVEDPRKMLLA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctagatcgatccgcacatcggcttccagagccatcaagagctctcaatgtatg
agaaccgtgtcttgtgcatctgcaaaaagatatgcatcttctagccttttcaccagacaa
agtgctcctagcagaattccccaaaatttaaacagtcagtttatttctcgctccctgtta
cagcgccgtttggaatcaactaaggtggaggttccacctatggctgaatctttgactgaa
ggtactctttctcaatataccaagcaagtgggtgaatctatccaacaagatgaactattg
gctactatcgaaactgataagattgacatcgaagtcaacgctcccgtgagcggtaagatt
gttaaattgagcttcaagcctgaagataccgttactgttggtcaagaattggctcaaatt
gaagagggtgaagtctctactggtggcgaagctccaaaagaagagccaaaacctgaagaa
ccgaagaaggaagaaccagctgctgctgccccacctcctccaaagcctgaggctccaaag
aaggaagctccaaaaccagctgccccaaagaaggaagctccaaagaagccagaaccagct
ccacaagctccaaaaaccacttccttctctcgtaatgaggaaagaattaagatgaaccgt
atgagattgagaattgcagaaagattgaaggaatctcaaaacaccgcagcttctttgacc
actttcaacgaagttgatatgtccgctttgttggagatgagaaagctttacaaagatgaa
atcatcaagagcaagggtgtgaaattcggtttcatgggtctattctctaaggcaagtaca
ttggccgccaaggatatcccatctgtcaacggtgccattgaaggtgaccaaatcgtctac
agagattacagtgacatttctatcgctgttgctactcctaagggtttggttacccctgtg
atccgtaacgctgaatccttgtccgttttggaagttgaacaagaaatcgtccgtctatct
caaaaggctcgtgatggtaaattgacccttgaagatatgagtggtggtactttcaccatt
tccaacggtggtgttttcggctctctatacggtactccaatcatcaacaccccacagact
gctgtgttaggtttgcacggtgttaaggaaagaccagtgaccgttaacggtaagatcgaa
tctagacctatgatgtacttggcattgacttatgatcacagattgatggacggtagagag
gccgtgactttcttgagaaccgtcaaagaattggttgaagacccaagaaagatgcttctt
gcctaa

DBGET integrated database retrieval system