KEGG   Zygosaccharomyces rouxii: ZYRO0F10604gHelp
Entry
ZYRO0F10604g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZYRO0F10604g
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZYRO0F10604g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ZYRO0F10604g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(866249..867151)
Genome map
AA seq 300 aa AA seqDB search
MSQLSIVLAPFSGGQPRKGVDLGPKFMLKQGLPTHLKDLGYQVEINEPLAGLPEAEEDDK
FGHIKNPTSVGDATKLIYQNNLNVLDKGSFPLTLGGDHSIAIGTVSAVLEKHPDAGLLWI
DAHADINTLESTVSGNLHGCPVSFLMGLNENVPESLQWVPKRLRPNKIAYIGLRDVDAGE
KEIIRKLGISAYSMYHIDRYGMNKVIEMALEAIGSGPIILSYDVDAIDPQYVPATGTPVR
GGLTLREALFLPERLAETKRLVAMDVVEVNPRLASNDVHVVDTISAGCAVARCALGETLL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaactatctattgtcctagctcctttctctggtggtcagcctagaaaaggtgtc
gatctaggaccaaagttcatgctaaagcaaggtctacctacccatttaaaagatttagga
taccaagtggaaatcaacgaaccactagctggtttacctgaagctgaagaagacgataaa
ttcggtcacattaaaaacccaacgagtgtgggtgatgcaacaaaattgatctatcaaaac
aatctaaatgttcttgataaaggctcattcccattgactctcggtggtgatcacagtatt
gccattggtaccgtaagtgcagttctagagaaacatcctgatgcaggtttgctgtggatt
gatgcacatgctgatatcaatactctagagtctacagtttccggtaatttacacggttgt
ccagtatcgttcttaatgggactcaacgaaaatgtacctgaatcattacagtgggtacct
aaaagattacgcccaaataagatagcttacatcgggttaagagatgtggatgcaggtgag
aaggaaatcattagaaaattaggtatctccgcctattccatgtaccacatcgatcgttac
ggtatgaacaaagtaatcgaaatggcattagaggcaatagggtccggtccaattattcta
tcctatgacgtagacgcaatcgacccccaatacgttccagcaactggtacacctgttaga
ggtggcttaacattaagagaggcacttttcctaccggaaagattggctgagaccaaaaga
ttagtagctatggacgttgtcgaagtaaatccaagattagcatccaatgacgtgcatgtc
gtcgataccattagtgctggttgcgctgtggccagatgtgcactaggcgagacattgcta
tag

DBGET integrated database retrieval system