KEGG   Zygosaccharomyces rouxii: ZYRO0F10780gHelp
Entry
ZYRO0F10780g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ZYRO0F10780g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(879680..881686)
Genome map
AA seq 668 aa AA seqDB search
MPDPLDNFYRQFQLFVQNNPNVISAARAASQIPESAKAVVVLSPYSLEHSFGRNWVSKSY
LKSIVERPERLLASSLGIAAAITMYPALYTLKSSDRKKSSILSPHVLKVHGKDWPPQLLR
LCKEADAKLAAKEVEVPASWNAGDIYLSSKTVEALQGSIGALETAVDSIFDGPSPEHISN
RAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRFGVTHAAILDFDLHHGDGTQDIC
WKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSMHDINSFPTESGYATKENVKNASTC
IMNAHDVNIWNIHLSPWETEEDFAKLYHTKYRSLFVKADEFFKQGKIEMAAQNKPFKGLV
VISSGFDASEFEQTSMQRHGTNVPTYFYTAFTKDALKLSQMHCHGKVLSIMEGGYSDKAI
VSGVFAHLIGLQNQNWIKEWGSEHVVKEIVRGCKSNWKPYKTKKARDVIRIWAEEVIKLG
RAMIPGFETLFQDIPSNNKVAAANVAPRVTRSKAQTTKSTHREPTGTTLDPSKETPAAPR
HRRIEGTGVTQEPVPFTQEELHSEDDNDDEDYVYDEELNKTFNRTVEDITIDDISRHLET
LEIIEQPPPAPTAQSKYKVPSKTTTQHLRSSTRPQQLANSNASADDSDISMVSHVSTRKH
TTRSGARW
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgccagatccactagataacttttacaggcagtttcagctgtttgtacagaataatcct
aatgtgatatctgcggctagagcagcttcccagattcctgagagtgccaaggctgttgta
gtattgtctccatattctttagagcattcttttggtcggaattgggtatctaaatcgtac
ctcaagagtatagtggaaagaccagagaggttattagcgagttcgttgggtatagcagct
gcaattaccatgtatccggcactttatactttaaaatcgagtgatagaaagaaatcttct
atattgtcaccgcatgtgctaaaggttcatggtaaagattggcctccgcaactgctaaga
ctttgtaaagaggcagatgcaaaattggcagcaaaagaggtggaagttcccgcatcttgg
aatgcaggtgatatctatctaagttcaaaaacagttgaagcgttacaagggtcgattgga
gccctagagactgctgttgactccatttttgacggtccatccccagagcacatcagtaat
agagcgtttgttgccatcagaccgccaggacatcattgccatgtagcaacaccgtcaggg
ttttgtcttttgaacaatgcacatgttgctattgagtatgcaaaagatcgttttggagtt
acccatgctgcgatattagatttcgatttacaccatggtgatggtactcaagacatatgt
tggaaaagagctgggtttagaccggatgaagaggatgaagattcaccaggttacgattca
tttgggaaaaaatttgcagagtatcctcgagttggttatttttcaatgcatgatatcaat
tccttccccacagagagtggatacgcaactaaggaaaatgttaaaaatgcttcgacgtgt
atcatgaatgctcatgatgttaacatttggaacatccatctttccccgtgggaaacagaa
gaagactttgctaaattgtatcacaccaaatacaggtctctatttgttaaagcagatgaa
ttctttaaacaaggtaaaattgaaatggcggctcaaaacaaaccattcaaaggcctggtt
gttatcagttccgggtttgacgccagcgaatttgaacaaacgagcatgcaaagacatggt
acaaatgtacccacgtatttctacacagccttcactaaggatgccctcaagctatcacaa
atgcattgtcatggtaaagtcttatccataatggaaggtggatattcagacaaggcaatc
gtatcaggggtttttgcccatttaataggtctacaaaatcagaattggattaaagaatgg
ggctcagaacatgtcgttaaagaaatagttagaggttgtaaatctaattggaaaccttac
aagaccaagaaggcaagagatgtcatcagaatatgggcggaagaagtgattaaattgggg
agagctatgatacctggctttgaaactcttttccaagatataccttcgaacaataaggtt
gccgctgcaaacgttgctccaagagttactagatcaaaggctcaaacaacgaagagcacg
catcgtgaacctacaggtacgactttggacccatcaaaggaaactcctgctgctcctcgt
catagacgtatcgaaggtacgggcgttacacaagaaccagtaccatttacacaagaggaa
ctacacagtgaagacgacaatgatgacgaggattatgtatacgacgaagaattgaacaag
actttcaacaggaccgtggaagatattaccatcgatgacatctcgaggcacttggagact
cttgaaattatcgaacaaccacctccagcacctacagcacaatccaagtacaaggtacct
tccaaaaccactactcagcatttacgttcgtctacaagaccccaacaactagcaaattca
aatgccagtgcggacgacagcgacatatcaatggtttctcacgtttctacgaggaaacat
acgacccgtagtggtgccaggtggtga

DBGET integrated database retrieval system