KEGG   Zygosaccharomyces rouxii: ZYRO0F11088gHelp
Entry
ZYRO0F11088g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
zro  Zygosaccharomyces rouxii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    ZYRO0F11088g
  Replication and repair
   03420 Nucleotide excision repair
    ZYRO0F11088g
Transcription machinery [BR:zro03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ZYRO0F11088g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:906284..907813
Genome map
AA seq 509 aa AA seqDB search
MSSQHLLKSSVNQYLEELPQQIQSRLYESPATCLAIYRLLPQLAKFFIMSMVFNESAISL
RDLDRWVKSSGKLQFQDAIKSMKSLHLLIPVRSNGPMLIDLNHTFRESFKNALTGGEVSN
SFGIVMELDNDTVTTDMLDKYSADKWETILHFMVGTSLAHIPSENVLNLLKHSKLMEESN
TTGEFKITNEGFQFLLQEVNSQLWALLLQYLKMTEMLQMDPVDILNFIFMLGALEFSKPY
STNGLSETQKVMLKDMRDYGLVFQMNSNANVFYPTRLASMLTSDPKSIRGASGAMDSVLK
QNKEDVLNKSGGAGANADDDADEIGSEGQNMQDGALIVETNFKLYSYSNSPLQIAILSLF
VHMKSRFSNMVTGQLTRESIRQALLNGITADQIIAYLETHAHPQMRRMAEEQLEKRLELD
PNSKDPLQILPPTVVDQIKLWQLELDRIISFEGSLYSDFENHQEFTLLSSYAQDIGVLIW
KDDRKKKFFVSKEGNSQVLDYAKRKLKKK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgagttctcagcatctgttgaaaagttcagttaaccaatacttggaagaattaccgcag
caaattcagagtaggttatatgaatctcctgctacatgtttggccatctacaggctctta
cctcaactggcaaagttttttattatgtcaatggttttcaatgaaagtgctatttcactt
cgtgatttagataggtgggttaaatctagtggtaaacttcaatttcaggatgctatcaaa
tctatgaagtccctgcatctgcttataccagttagaagtaatggaccgatgcttattgat
ctgaaccatacctttagggagagttttaaaaatgcattgaccggaggtgaagtgagtaat
tctttcggtattgttatggaattggataatgacacagtcactactgatatgttggacaag
tattcagctgataagtgggaaactattttgcatttcatggtagggacatctctggcgcat
ataccgtctgaaaacgttttaaaccttttaaaacacagtaaattgatggaagagagtaac
acgacgggggaattcaaaatcactaatgaggggtttcaatttcttctacaggaagtaaac
tcacaactgtgggcacttcttctacaatatttaaaaatgacagaaatgttacagatggat
ccagtggatatattgaattttatctttatgttgggtgcattagagtttagcaaaccatat
agcactaatggattatcagagactcaaaaagtcatgttaaaggatatgagagattacggt
ttggttttccaaatgaattccaatgcgaatgtcttttatccaacacgattggcatcgatg
ttaacatctgatcccaagagtattagaggtgcttctggtgccatggatagtgttctaaaa
caaaataaagaagatgttcttaataaaagcggtggtgcaggtgccaatgcagatgacgat
gcagatgaaatcggttctgagggccagaatatgcaagacggtgcattgatcgtggagacg
aatttcaaactatattcgtattcgaattcacctttgcaaattgccattttgagtcttttc
gttcatatgaaatcaagattttccaatatggttactggtcaattgacaagagaatctatt
agacaagcattgctaaatggtattacagcagatcaaattattgcatatttagagacacac
gctcatccacagatgagaaggatggctgaggagcaattagagaaaagattggaattggat
ccgaatagtaaagatccgttacaaattttaccacctacggttgtagatcaaattaaattg
tggcaattggaattggatagaattattagtttcgaaggatcactttactctgattttgaa
aaccatcaggaattcaccttacttagctcctacgctcaggatattggcgttttaatatgg
aaggatgataggaagaagaaattcttcgtctctaaggaaggtaattctcaagttctcgat
tatgcaaagagaaagttgaagaagaaataa

DBGET integrated database retrieval system