KEGG   Zygosaccharomyces rouxii: ZYRO0F11418gHelp
Entry
ZYRO0F11418g      CDS       T01118                                 

Definition
hypothetical protein
Organism
zro  Zygosaccharomyces rouxii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(936573..938117)
Genome map
AA seq 514 aa AA seqDB search
MNFQAPSLFHGRTQKKRNLKQLALPQNAIDGNAYGCEITTSAQEHGSSNENLHDMNNIRL
GSSSSSSSGKLNFPKNDASNLYLRRGFKGKIHLNNNSALDLKNENRNGSNEGLGMVQQSF
VVSSPTNSSPSTTTSLNHVFTPMDEEVSVGLPEGELSKSSIFRNSDSSTSGTTGNSIKLD
NLVQLGKIGSGNSGTVIKALHVPDSRIVAKKTIPVENNNHLVVNQLVRELTIMKSVHMHD
NIVSFYGAYYTHASNNEIIILMEYMNCGSLDKILSVYKRYVARHTSSRAVPWFNGLVISK
ISNGVLNGLLYLYERYKIIHRDIKPSNVLINSKGQVKICDFGVSKKLINSIADTFVGTST
YMSPERIQGNVYSIKGDVWSLGLVIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPKL
PQGQGYEFPKEMIDFVNRCCVKEESQRSSIQELLCHDFINMYKSRDKDYKHWCKKVKVRI
REDKQIRREDNERVKLEQKQLEKAAEAATTARRS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcaagcaccgagccttttccatggtaggacccagaagaaacggaatcttaag
cagttggcgttaccacagaatgcaattgatgggaatgcgtatggatgtgaaataacgacc
agtgcacaggagcatggcagtagcaatgaaaatttacatgacatgaataatataagactt
ggatcatcttcctcatcgtcatcaggtaaattaaatttccccaaaaatgatgcaagtaat
ctatatctccgaaggggattcaaaggtaagattcatttaaacaataactcagcactcgac
ctgaagaacgagaatagaaatggtagtaatgagggtttggggatggtacaacagtctttt
gtagttagtagtccaactaattcgtcaccatccactactacaagtcttaatcatgtattt
accccgatggatgaagaggtatctgtgggattaccagagggcgaattgtcgaaatcttcg
attttcaggaatagtgattcaagtacaagtggtactacgggcaattcgatcaaattagac
aatctggttcagttggggaagatcggttcgggaaattcaggtacagttataaaggcgtta
catgtacctgactctagaattgttgccaagaaaactattcccgttgaaaataataatcat
ttagtagtaaatcaactggttagagaattaaccattatgaaaagtgttcacatgcatgat
aatatagtttcgttttacggtgcatattatacacacgcaagtaataatgaaatcatcata
ctgatggaatatatgaattgtggatctctggataagattctttcagtttacaaaaggtat
gtggcaagacatacatcaagtagagctgtaccttggtttaatggattagtcatttcaaag
atttccaatggcgtattaaacgggctattatacctttatgaacgttataaaattattcat
cgagatattaaaccctcgaatgtcttgattaatagtaaaggtcaagttaaaatttgcgat
tttggagtttccaaaaaattgattaattcgattgccgatacctttgttggtacctcaaca
tatatgtcgcctgaacgtatacaggggaacgtttactcgataaagggtgacgtttggtca
ctgggtcttgtaattattgaattggtaacgggcgaattcccattaggtggtcataatgac
actcctgatggtatattagatcttttacagagaattgtcaatgagccatctccgaaatta
ccacagggacaaggttatgaattcccgaaggaaatgattgactttgttaatagatgttgc
gttaaagaggaatctcaaaggtcgtcgatacaagaattgttatgccacgatttcataaac
atgtacaaatcaagagataaggattataaacactggtgtaaaaaggttaaagtaaggata
agggaggataaacagattagacgtgaagataatgaacgtgtaaaacttgaacagaaacaa
ttagagaaagccgcagaagctgctacaacagcaaggcggtcgtga

DBGET integrated database retrieval system