KEGG   Zygosaccharomyces rouxii: ZYRO0F13046gHelp
Entry
ZYRO0F13046g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K06634  cyclin H
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro03022  Basal transcription factors
zro03420  Nucleotide excision repair
Module
zro_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    ZYRO0F13046g
  Replication and repair
   03420 Nucleotide excision repair
    ZYRO0F13046g
Transcription machinery [BR:zro03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ZYRO0F13046g
DNA repair and recombination proteins [BR:zro03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     ZYRO0F13046g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB
Motif
Other DBs
NCBI-GeneID: 8205535
NCBI-ProteinID: XP_002497768
UniProt: C5DYH4
Position
F:complement(1065724..1066776)
Genome map
AA seq 350 aa AA seqDB search
MSDNPQSKNGAPAKPANYRRLTDDDLFRHSSQYRFWSFTPDQLKQKRIEVNAHAVVSVEE
DLRKFIAEHRDNLSDEELRTIEERAVPVNMDEEVKLVNFYAKKVQAIAQRLNLPTEIVAT
AITFFRRFFLENSVLEIEPKTIVFTTIFLACKSENYFIGIDSFAAKTKGSKTEILKYEFK
ILENLKFCLMNHHPYKALHGFFLDIQVILHGKVDLKYMGQIYDRCKRRITNALLTDVVYY
YAPPQITLAALMLEDEALTTRYLELKFHGNTETENPNQDANVSINFDKLISMINSCKDII
ENAPPVPVEEAKAIMAKVLYSRNPQVLLNKLKRKNPSESPEDSPDKRPKT
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataatccacaatcaaagaatggagcccctgcgaaacctgctaattacagaaga
ttgactgatgatgatttattcagacattcgtctcaatatagattttggtcattcactcca
gatcagttaaaacaaaagagaatcgaagtaaatgctcatgccgtagtatcagtagaagag
gatctacgtaaattcattgcagaacatagggataatttgagtgatgaagaattgagaacg
atcgaagagagggcagtgccagttaacatggatgaagaagttaaactagtgaacttttat
gcaaaaaaagtgcaggcaattgcccaaagattgaacctacccacggagattgtcgcaacg
gctataacgttctttagaaggtttttccttgaaaattctgtcttggagattgaacccaag
accatcgtattcacaactatatttctggcatgtaaatctgaaaactactttattggcatt
gattcatttgctgcaaagacaaaaggttccaaaactgaaattttaaaatacgaatttaaa
atattagaaaatctcaaattctgcttaatgaatcaccatccttacaaggctctacatgga
tttttcctcgatattcaagttatccttcatggtaaagttgatttaaaatatatgggtcaa
atttacgatagatgtaagagaaggattaccaatgcattactcacagatgtcgtttattat
tatgcgccaccacaaataactttagcggctctcatgttggaagatgaagctctaacgacg
agatatttagaattaaaattccatggtaatacagaaactgaaaacccaaaccaagacgct
aatgtttccataaattttgataaactgatatccatgattaattcttgtaaagatattatt
gaaaacgcacctccagtacctgtggaagaggcgaaggcaataatggctaaagtactttac
tctcgaaatccacaggtactactgaataaactgaagaggaagaatccatcagagagtcct
gaggactcacctgacaaaagacccaaaacttaa

DBGET integrated database retrieval system