KEGG   Zygosaccharomyces rouxii: ZYRO0F13970gHelp
Entry
ZYRO0F13970g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00318  
proline dehydrogenase [EC:1.5.-.-]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZYRO0F13970g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.-  Acting on the CH-NH group of donors
    1.5.-.-  
     ZYRO0F13970g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1149055..1150473
Genome map
AA seq 472 aa AA seqDB search
MSLRSGTGQLHNIYGSLRPMFRAGTLQSARFVSQTSTHKNSAVAFDAVNPSTKMSADVKA
PSSVAYLKTLSKPELFSLGVIGCVTTSKHLLNLVIGLFPYVPMFLIKIFVSRLYCGGDNV
EEVRQCGERLQKRGISNMMLSLTIEDSEGVKNIDINHIVKETIRSVHEVLKPNLLNQLET
AVDVNDVAPGYIALKPSALVANPSQVLLNFKNPAWKEQRDQLVNNCAAITQTVYDLNQEL
LKKYPTRKAPFFVSTIDAEKYDLQNSGVYELQRILFEKFNPASSPIVSCIGTWQLYLTDS
AEELEIERQRAEREGYKLGLKLVRGAYIHSEPDRNVVIQPSKEASDINYNTVMTKVIQDL
SSNGKNSTYGHLVVASHNYYSQMLATEELKGKENTYGKCNVVLGQLLGMADNVTYDLIEN
HGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVRADNGWPLVKSIAKSLFRA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttagatcaggaacaggtcagctacacaacatttacgggtctctaagacctatg
tttagagctggtactcttcaaagtgcaagatttgtatctcagacttctactcacaaaaac
agtgctgtggcattcgacgctgtaaacccaagtactaagatgagtgctgatgtaaaggct
ccaagttcggtagcctatttgaagaccctatctaaaccagaacttttctctttaggtgtt
attggatgtgtcaccacaagtaagcatttgttgaacttggttatcggattatttccttat
gtgcctatgttccttatcaaaatatttgtttccaggctgtactgcggtggtgataacgtc
gaagaagttagacaatgtggtgaacgtctgcagaaacgtggtatcagtaacatgatgttg
tccctaactattgaggattccgaaggtgtgaagaacatcgatatcaaccacatcgttaag
gaaactattagatctgtgcacgaagttttgaaaccaaaccttctgaatcaacttgaaact
gctgtcgatgttaacgatgtagctcccggttacattgccttgaagccttctgcgttagtg
gctaacccaagtcaagtccttttgaatttcaagaatcctgcatggaaagaacagcgtgac
caattggttaacaactgtgctgccattactcaaaccgtttacgacttgaatcaagagttg
ttgaagaaataccctaccagaaaggctccattctttgtttctaccatcgatgctgaaaaa
tacgatttacaaaacagtggtgtttatgaattgcaaagaatccttttcgaaaaatttaac
cctgcatctagtcctattgtctcttgtattggtacctggcaattgtatttaaccgattct
gccgaagaattggaaattgaacgtcaaagagctgaacgtgaaggttacaagttaggtctt
aaattggttcgtggtgcttacattcactctgaacctgatcgtaatgtggtcattcaacca
tcaaaggaagcttctgatattaactacaacactgttatgactaaagtaatccaagatcta
tcctctaacggtaagaattcaacctacggtcatttggtggttgcatctcataactactac
tctcaaatgttggccactgaagaattgaaaggtaaggaaaacacctacggtaaatgtaat
gtcgtgctaggtcaattgctgggtatggctgataacgttacctatgatttgatagagaac
catggtgcaaagaatattatcaagtacgttccttggggaccaccattagaaaccaaggat
tacctattgagaagattgcaagaaaacggtgatgctgttagagctgacaatggttggcca
ttagtgaagtccattgccaagtctttattcagagcatga

DBGET integrated database retrieval system