KEGG   Zygosaccharomyces rouxii: ZYRO0F14410gHelp
Entry
ZYRO0F14410g      CDS       T01118                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:zro01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zro00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:zro00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:zro00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:zro00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(1182860..1184887)
Genome map
AA seq 675 aa AA seqDB search
MTTKEHKTVHEAQNVVARHAPEHFYKSQPGLGYVKDMKQYQEMYKQSVEDPETFFGTKAQ
ELLHWDKPFTKTKFGSLENGDTTWFLNGELNAAYNCVDRHAFANPDKPALIYEADEEADN
RVVTFGELLRQVSQVAGVLHSWGVRKGDTVAVYLPMIPEAVVAMLAVARLGAIHSVVFAG
FSAGSLKDRVVDAGCKVVITCDQGKRGSKTVHTKKIVDEGLNGISQVSHILVFQRTGAEG
IPMTPGRDYWWHEEAAKQRGYIPPVPCSAEDPLFLLYTSGSTGSPKGVVHSTGGYLLGAA
MTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLALGTASIIFESTPAYPDYGRYWRII
QRHKATHFYVAPTAMRLIKRVGEAEIPKYDLSSLRVLGSVGEPISPDLWEWYNEKIGHNN
CVVCDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGVDACIIDPVTGVELQGNDVEGVL
AVKSSWPSMARSVWQNHNRFQETYLQPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTAEIEASLTNHDNVSESAVVGIPDELTGQTVIAFVALKDGTPSQGDASANVRRELV
LQVRGEIGPFAAPKCVILVKDLPKTRSGKIMRRVLRKVASNEADQLGDLSTMANAEVVPG
IIAAVDEQYFAEKKK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgacaactaaggaacataagaccgttcatgaggcacagaatgtagtagctcgtcatgca
cctgagcatttctacaaatcacaaccaggattgggttatgtcaaggatatgaagcagtac
caagagatgtacaagcaatctgtggaagatccagaaacctttttcggtaccaaggctcaa
gaattgttacattgggataaaccatttacaaagacgaagtttggttcattggaaaatggt
gatactacttggtttttaaacggtgagttgaatgctgcttacaactgtgttgatagacat
gcttttgccaatcctgataaaccagcattgatctacgaagcggatgaagaagcagacaac
agggttgttacattcggtgagcttttgagacaagtttctcaagttgctggtgttcttcac
agctggggggttagaaaaggtgataccgtcgcagtttatctaccaatgattcctgaagct
gttgttgcaatgttggccgttgccagattaggtgcaattcattctgttgtttttgcaggt
ttttcagcaggttccttgaaggatcgtgttgtagacgcaggttgtaaagttgttattact
tgtgatcaaggtaaaagaggtagcaaaaccgttcatacaaagaaaattgtcgatgaaggt
ttaaatggaatttctcaagtttctcatattcttgtcttccaaaggacaggtgctgaaggg
atcccaatgacacctggcagagattactggtggcacgaagaagctgctaagcaaagaggt
tacattccaccagttccttgtagtgctgaagatccattattcctcttgtacacttcaggt
tccaccgggtcaccaaagggtgtggtccattcaaccggtggttatctattgggtgcagcc
atgaccactagatatgtgtttgacatccatccagaagatgtcttattcacagcaggtgat
gttggttggattacaggtcatacttatgctctttatggtccattagcgctaggtactgca
tcaatcatctttgaatcaacaccagcttatcctgattacggtagatattggagaatcatt
cagcgtcataaggcaactcatttctacgtggctccaacagccatgagattgattaagcgt
gtaggtgaggctgaaattccaaaatacgatctatcttcactaagagttcttggatcagtc
ggtgaaccaatttcaccagatctttgggaatggtacaacgaaaaaattggtcacaacaac
tgtgtcgtttgtgataccatgtggcaaaccgaatctggttctcatttaattgctccatta
gcaggtgcagtcccaacaaaacctggttccgctacagttccattctttggtgttgatgct
tgtatcattgacccagtcactggtgttgaattacaaggtaatgacgtggaaggtgttttg
gcagtaaaatcatcttggccatctatggcaagatcagtttggcaaaatcacaaccgtttc
caggagacttacttgcaaccataccctggttactactttacaggtgatggtgcaggtaga
gaccatgatggttactactggatcagaggtagagttgatgatgtggttaacgtttctggc
cacagattgtccactgctgaaattgaagcttcattgaccaaccatgataatgtttctgaa
tctgctgtcgtaggtattcctgacgaattgaccggtcaaaccgtcattgccttcgttgca
ttgaaagatggtactccaagtcaaggtgatgcgagtgctaacgttcgtcgtgaattggtg
ctccaagttagaggtgaaattggtccatttgctgctcctaaatgtgtcatcttggttaaa
gatctgccaaagactagatccggtaaaatcatgagaagagtcctaagaaaagttgcatct
aatgaagctgatcaactgggtgatctatctactatggctaacgctgaagtcgttccaggt
atcattgcagctgttgatgaacaatattttgctgagaagaagaaataa

DBGET integrated database retrieval system