KEGG   Zygosaccharomyces rouxii: ZYRO0F14410gHelp
Entry
ZYRO0F14410g      CDS       T01118                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZYRO0F14410g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0F14410g
   00620 Pyruvate metabolism
    ZYRO0F14410g
   00640 Propanoate metabolism
    ZYRO0F14410g
  Energy metabolism
   00680 Methane metabolism
    ZYRO0F14410g
Enzymes [BR:zro01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ZYRO0F14410g
Lipid biosynthesis proteins [BR:zro01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ZYRO0F14410g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(1182860..1184887)
Genome map
AA seq 675 aa AA seqDB search
MTTKEHKTVHEAQNVVARHAPEHFYKSQPGLGYVKDMKQYQEMYKQSVEDPETFFGTKAQ
ELLHWDKPFTKTKFGSLENGDTTWFLNGELNAAYNCVDRHAFANPDKPALIYEADEEADN
RVVTFGELLRQVSQVAGVLHSWGVRKGDTVAVYLPMIPEAVVAMLAVARLGAIHSVVFAG
FSAGSLKDRVVDAGCKVVITCDQGKRGSKTVHTKKIVDEGLNGISQVSHILVFQRTGAEG
IPMTPGRDYWWHEEAAKQRGYIPPVPCSAEDPLFLLYTSGSTGSPKGVVHSTGGYLLGAA
MTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLALGTASIIFESTPAYPDYGRYWRII
QRHKATHFYVAPTAMRLIKRVGEAEIPKYDLSSLRVLGSVGEPISPDLWEWYNEKIGHNN
CVVCDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGVDACIIDPVTGVELQGNDVEGVL
AVKSSWPSMARSVWQNHNRFQETYLQPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTAEIEASLTNHDNVSESAVVGIPDELTGQTVIAFVALKDGTPSQGDASANVRRELV
LQVRGEIGPFAAPKCVILVKDLPKTRSGKIMRRVLRKVASNEADQLGDLSTMANAEVVPG
IIAAVDEQYFAEKKK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgacaactaaggaacataagaccgttcatgaggcacagaatgtagtagctcgtcatgca
cctgagcatttctacaaatcacaaccaggattgggttatgtcaaggatatgaagcagtac
caagagatgtacaagcaatctgtggaagatccagaaacctttttcggtaccaaggctcaa
gaattgttacattgggataaaccatttacaaagacgaagtttggttcattggaaaatggt
gatactacttggtttttaaacggtgagttgaatgctgcttacaactgtgttgatagacat
gcttttgccaatcctgataaaccagcattgatctacgaagcggatgaagaagcagacaac
agggttgttacattcggtgagcttttgagacaagtttctcaagttgctggtgttcttcac
agctggggggttagaaaaggtgataccgtcgcagtttatctaccaatgattcctgaagct
gttgttgcaatgttggccgttgccagattaggtgcaattcattctgttgtttttgcaggt
ttttcagcaggttccttgaaggatcgtgttgtagacgcaggttgtaaagttgttattact
tgtgatcaaggtaaaagaggtagcaaaaccgttcatacaaagaaaattgtcgatgaaggt
ttaaatggaatttctcaagtttctcatattcttgtcttccaaaggacaggtgctgaaggg
atcccaatgacacctggcagagattactggtggcacgaagaagctgctaagcaaagaggt
tacattccaccagttccttgtagtgctgaagatccattattcctcttgtacacttcaggt
tccaccgggtcaccaaagggtgtggtccattcaaccggtggttatctattgggtgcagcc
atgaccactagatatgtgtttgacatccatccagaagatgtcttattcacagcaggtgat
gttggttggattacaggtcatacttatgctctttatggtccattagcgctaggtactgca
tcaatcatctttgaatcaacaccagcttatcctgattacggtagatattggagaatcatt
cagcgtcataaggcaactcatttctacgtggctccaacagccatgagattgattaagcgt
gtaggtgaggctgaaattccaaaatacgatctatcttcactaagagttcttggatcagtc
ggtgaaccaatttcaccagatctttgggaatggtacaacgaaaaaattggtcacaacaac
tgtgtcgtttgtgataccatgtggcaaaccgaatctggttctcatttaattgctccatta
gcaggtgcagtcccaacaaaacctggttccgctacagttccattctttggtgttgatgct
tgtatcattgacccagtcactggtgttgaattacaaggtaatgacgtggaaggtgttttg
gcagtaaaatcatcttggccatctatggcaagatcagtttggcaaaatcacaaccgtttc
caggagacttacttgcaaccataccctggttactactttacaggtgatggtgcaggtaga
gaccatgatggttactactggatcagaggtagagttgatgatgtggttaacgtttctggc
cacagattgtccactgctgaaattgaagcttcattgaccaaccatgataatgtttctgaa
tctgctgtcgtaggtattcctgacgaattgaccggtcaaaccgtcattgccttcgttgca
ttgaaagatggtactccaagtcaaggtgatgcgagtgctaacgttcgtcgtgaattggtg
ctccaagttagaggtgaaattggtccatttgctgctcctaaatgtgtcatcttggttaaa
gatctgccaaagactagatccggtaaaatcatgagaagagtcctaagaaaagttgcatct
aatgaagctgatcaactgggtgatctatctactatggctaacgctgaagtcgttccaggt
atcattgcagctgttgatgaacaatattttgctgagaagaagaaataa

DBGET integrated database retrieval system