KEGG   Zygosaccharomyces rouxii: ZYRO0F17908gHelp
Entry
ZYRO0F17908g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ZYRO0F17908g
Enzymes [BR:zro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ZYRO0F17908g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ZYRO0F17908g
  Exosomal proteins of colorectal cancer cells
   ZYRO0F17908g
  Exosomal proteins of bladder cancer cells
   ZYRO0F17908g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1483368..1484906
Genome map
AA seq 512 aa AA seqDB search
MFSKNLVTLLTLALGAFAQDATAPKGSDVVKLDTSSFAEYIESHPLVLAEFFAPWCGHCK
NLAPEYVEAASALKKDNISLAQIDCTEDQELCMDQGIRGYPSLKVFKGGDPSKALEYEGG
RTAESIINYMVKQSLPSVQVFDDEKAFEELLKESVQPVVVFNGDKNLNQTFHKVADSLFN
EFTFASFDGAKEYLAVHLPNEDEPISFKGDRKGIEKSADDLEAWIKIEGLPYFGEVNGQT
FGAYVESGLPLAYFFYNDDDERKEYSSFFTKLGKEYRGKLSFAGLDARKFGRHAENLNMK
EQFPLFAIHNMSSNLKYGVAQLPDEKYEKLDKPLKLSTKEVSKLVNDVVSGKAEPIVKSE
EIPEKQESNVIKIVGKTHDQLIEDNKKDVLVKYYAPWCGHCKRLAPIYEQLADILASDDK
TSKSFVIGDIDATENDVPGVDLEGYPTIILYPAGKNSKPVVFEQERSVESFLAFLKKNGG
TKLDLEKVYEKYQAEQKKADEDESDETGHDEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttttccaagaatctggttacattgcttacgctggcacttggtgcattcgcacaagat
gcaactgctcctaagggctctgatgtcgttaagctagatacatcaagctttgcggaatac
atcgaatcacatccattagtactagcagaatttttcgcaccatggtgtggtcattgtaag
aatttggcacctgaatacgtggaggctgctagtgccctaaagaaggataacatttcatta
gctcagatcgattgtacagaggaccaagagctatgtatggatcaaggtatcagaggttac
ccatctttgaaggtttttaagggtggtgatccaagtaaggccctagaatatgaaggtggt
agaaccgctgaatcaattatcaactacatggttaaacaatcattaccatcagtccaagtt
tttgatgatgaaaaggcatttgaagaattgttaaaggaatcagtacaaccagttgttgtt
ttcaacggcgacaagaatttgaaccaaactttccataaagtggctgacagcttgttcaac
gaatttacatttgctagtttcgatggtgctaaagaatatttggcagtacatctaccaaat
gaagatgagccaatcagtttcaagggcgaccgtaagggtatagagaagagtgcggatgat
ctagaagcatggattaagattgaaggtttgccatatttcggtgaagttaacggtcaaact
tttggtgcttacgtggaatccggtttgccattagcttacttcttctacaacgacgatgat
gaaagaaaggaatacagctcatttttcacaaaattgggtaaagaatacagaggtaaattg
agttttgcaggtttagatgcccgtaaattcggtagacatgctgaaaacttgaacatgaag
gaacaatttccactattcgcaatccataacatgagcagcaacttgaagtacggtgtggct
cagttgccagatgagaaatacgaaaaattggataaaccacttaagttgagcacaaaggaa
gtcagtaaattggttaacgacgtcgtttccggtaaagctgaaccaatcgtgaaatctgag
gaaatcccagaaaagcaagaaagtaacgttatcaagattgtcggaaagactcatgaccaa
ctgattgaagacaacaaaaaggacgttctagtcaagtactacgcaccatggtgtggtcac
tgtaagagattagcaccaatttatgaacaattagcagacatcctagcatctgatgataag
actagtaagagttttgtcatcggtgatattgatgctactgaaaatgacgtccctggtgtg
gatcttgaaggttacccaactatcatcctttacccagcaggtaagaactccaaaccagtg
gtctttgaacaagaaagatcagtggaatcctttttggccttcttaaagaagaacggtggt
actaaattagacttagaaaaggtttacgaaaagtaccaagctgaacagaaaaaggctgat
gaagacgaaagtgatgaaactggacacgacgaattgtag

DBGET integrated database retrieval system