KEGG   Zygosaccharomyces rouxii: ZYRO0G01188gHelp
Entry
ZYRO0G01188g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
zro  Zygosaccharomyces rouxii
Brite
Enzymes [BR:zro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ZYRO0G01188g
Peptidases [BR:zro01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ZYRO0G01188g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:join(95655..95676,95759..97239)
Genome map
AA seq 500 aa AA seqDB search
MSDSKLEFNIKHAGKSYPISLGNNATAGELKSCVEDLTKVPLSRQKYMVKGGLVDDSAKL
VDVIKPGSTLMLLGTADAGLVSKPAEKNQFIEDLAPEEQLQRSSDLPIGFQNMGNTCYLN
STLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKIVLELQRCFQNLKNKSFKSVM
PMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLFHSLSVVFGDKFEDEFSINFKTT
TTDSANENDVSVKEESDTKLQCHISSNTNFLKNGLVESLHETIEKRSEFTGANSKYVVDK
QITRLPKYLTVQYVRFFWKRSTGKKSKILRKVSFPFQLDVSDMLTPEYMKEKIKVRDEFR
RIEKEKAEKDRDSKRRKIDSSNGSNLSSMTPRERYETEQALAQSEREHWEAEFKKHTPSE
VTEGENPSSLYELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKIES
LSGGGESDSALILIYKGFGL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactccaagttagaatttaatattaagcatgccggtaagagctatccaatttcg
ttgggtaataatgctactgctggagaactaaagtcttgtgttgaagacttgacgaaggtt
ccattatcacgtcagaaatacatggtaaaaggtggtttagtagatgatagcgcaaaactt
gtcgatgtgattaaaccgggatccactttgatgttattgggtactgcagatgcaggattg
gtatctaaaccagctgaaaaaaatcaatttattgaagatttggcaccagaagaacaattg
caaaggagtagtgatttacccattggtttccaaaatatgggtaatacctgttatttgaat
tcaactttacaagctttgtacaggataaaacctttgagagaattgattttaagttataat
ggttctgaaactgctacctcatcagcagcggactctacagttgaatcgcataagaaaatt
gtattagagttgcagcgttgtttccaaaatttgaagaataaaagttttaaatcagtaatg
cctatggttcttttaactgcgttgagaaaatgttatccacaatttgctgaacgtgattct
caaatgggcttttataagcaacaagatgcagaggagcttttcacgcagttgtttcattcc
ttaagtgttgtatttggtgataaatttgaagatgaatttagtataaatttcaaaacgaca
actacggatagtgccaatgaaaatgatgtcagtgtgaaggaagaatctgacactaaatta
cagtgtcacatttcaagtaataccaactttttgaaaaatggtctcgtagaatcattgcat
gaaactatagagaaaagatctgaatttactggggctaattccaaatatgtggttgataag
cagattactagactgcccaaatatttgacggttcagtatgtgagattcttctggaaaaga
tcaaccggtaaaaaatccaaaattttacgtaaagtttcattcccattccaattggatgtt
tccgatatgttaacaccagaatacatgaaagagaagattaaagttcgtgatgaatttaga
cgcatagagaaggaaaaagcggaaaaagatcgtgattctaagagacgtaaaatcgacagt
agtaatggttcaaatctaagttcaatgaccccacgtgagaggtatgaaaccgaacaggct
ttggctcaaagtgaaagagagcattgggaagccgaatttaagaaacatacgccaagcgag
gtaactgaaggtgagaatccttcttcgctatatgagttagtaggtgtcataactcatcaa
ggtgcaaattcagaatctggtcactaccaatcatttattagagatgattacgatgaggat
aaatggtataaattcaatgacgataaagttagcgtcgtagacaaagaaaaaattgaatct
ctaagtggtggtggtgaaagtgacagtgcactaatattgatttacaagggctttggccta
tga

DBGET integrated database retrieval system