KEGG   Zygosaccharomyces rouxii: ZYRO0G01606gHelp
Entry
ZYRO0G01606g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
Organism
zro  Zygosaccharomyces rouxii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(123893..127810)
Genome map
AA seq 1305 aa AA seqDB search
MLLKDESSEPAVGGSARGVASSSDLPPELVETEQIGETMSESEISEDPGKNELLDTQDSG
KVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYSRKVG
KTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLATLPIF
HLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAIYVSSD
SNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCINTLFKI
FKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILEYAPPD
LTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQTNFSTM
FWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTLDPENVGVYV
DALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLNDSVLLSIYKN
ESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEVDESVDDDII
QTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDAL
SVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHFIDTGT
VDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASR
RIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGLGVEFELP
NASQANANAPVEKENYVNIDSEPSPPPNDEPLLIDLDDDSDPNNHSKLNKNSNDDGKINE
FDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLE
NALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDET
QVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQ
IQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQ
RELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQL
YHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDET
ITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLEVTV
NT seq 3918 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgaaggacgaatctagtgaaccagcagttggtggatcagcgagaggcgtagcc
tccagtagtgatttaccacctgaattggtggaaactgaacaaattggtgaaacgatgagt
gaaagtgagatttctgaagatccaggtaagaatgaattgctagatactcaagattccggt
aaagttcctctgtatcctgaggctgctgcccgttttccttttaaaacggctgacaggctt
ctggacgatattctacacgatctgtcatttatcaattctgatgaccattcgattctttat
tctgatctaagcaatgggatattaaaatcgccggtgctgtcatactcgaggaaagtgggt
aaaaccagggcttataatttgggttcacttgttgatcaggttgtacttcagacaaaattc
gaatatgattcagtgtcgtgtcctcagcataaccatttgcaagtttttatgggggtgctt
atagatgtaacgcaacaaaatgtggcgacatttaacaatttggcaactttaccgattttc
catttaaaagtaacggtaaagaccagggatgtccttgaacgcaccaagaaaaaagcaggt
attacacattatcattctctggatgaaagtgaaatacatccttatgacaagcaagatctt
ttaacatttgattctaaggatccacaattgttggattatgccatctatgtgtccagtgat
tcaaacaaattgattttaatcgaaattttcaaaccagaatttgattcagacgaagaaaga
gatgcatttaaggaagaatctatcaataatagatatgagatggcttgtaacaggttcgat
tctcttgatccaacaagaatacccacgcaacctgattgcatcaacactctttttaaaata
tttaagggaccattgaataggaaaagctcagaggaaccgaggaaaaccatcaatccaaat
aatgtttctctcaactcacatatcgaccccacttggttgacctccaaatacggatttgaa
cttcatgttgaaaaagatgaggaaacaggtgaagatattctagagtacgccccacctgac
ttgaccaactaccatagagattggaaagtgagaagacttcgtgagtcttttactagaaga
tgcctggaattgatcttcttgggtagagtctccatcagattgctgtcgcaagaagccgtt
aatagaaatcctaaagtttatcggatctttagcatgatgcagactaacttctcgaccatg
ttctggtttcaacttttgggtgaatacagggctattttcagcacagaaagtagttctcca
ttagattcagatcatcatttcatagatctgtcagcttgttacaattacatcgacagggat
attattcgcaattatgaggcacagtgtacgttagatccagaaaacgttggggtctatgtt
gatgccctcaatttcatagcaaacaggaaaggtgcatatcagttaatcgcttattgtggt
aaacaagatttcgtcggccaggaagcattagatcatgcattgggcgttttccaaatcgat
tccaaagagtttgacccgcataacttgaatgatagtgttctattatcaatatacaagaat
gaaagcgccagtacaagaaatcccaacagacacgcagagttaaaaaattccttgaggctg
cttgctaagtttaaaaaatctccaaaattgaagttttatgctgattacgaaccctataga
aatgtgacacaggcatatgagattttggaagtcgatgaatctgttgatgatgatattatt
caaacggcatacacagtcaaagttaacgattcgccgggtctaaaaattgattgtgatagg
gcactttacactattgctgttcactcaagaagtttagcacttttcaatttcctggtgcag
caatccgaagaatttcaagagtattttggtcctgatcaattttcttaccaagatgccctt
tccgtcctgcaagttaatgagaatgcgggtgatgatacaatcttagaaatttttcaacgt
aaatggtataaagaaccagtatttgacgccgatcaatttttgaaattgaaaggcgcattg
tccaagattggatttgaacgaaattctaaactgatctcacattttattgacactggcaca
gttgatgcatcatgtcttcccgctgaaaattggcctaccgggttgaacaacatcggtaat
acctgttatttgaattcgcttctacaatactatttctcgatttcatctttaagacaatac
gttttggattatcgtaatactgtccaacatttcttgaacaatcaagaatatgcttcgaga
agaattggtggtagagaaattactgaagcggaagttgaaaggtcggtacagtttgtctac
caacttcgtgatttgtttgattctatgattcatgcccaagacagatgcgtcactccaaga
aaagaacttgcctacttggcatttgtacccagtgggttaggagtagaattcgaactacct
aacgcatctcaggctaatgcaaacgctccagttgagaaagagaattacgtcaatatcgat
tctgaaccttcaccaccacctaatgatgaacctttgctcatagatttggacgatgattct
gaccctaataatcattcaaagcttaacaaaaattctaatgacgacggtaagatcaatgaa
ttcgacaattctcaagcaggcgagaatgatgttgatgttgatatttctatgactgacagt
cctgctgaagaagagaaagttacaaaagccgacagtggatcctcaagtaacaattccaac
aaggcggtagccatgaacacttcgactcgtgtggctaagataagttccgatcaacttgaa
aatgcactggaaatggggagacaacaagatgtcacggagtgcattggaaacgttttattt
caattggaaagcgcttctgatccgataagcttgggtgatgacaatgaacaaaatgatttg
gtgaaacaattgttctatggtaatataaagcagaatattattcctttgaaagatgaaacc
caagttcgtaccaaatatgaacgctttttatcgttgttggttaatattggtgaccatcct
aaggatatctatgatgcattggacttgtacttccgagatgagtatttgaaattggaagaa
tacggtgatgtcaagagaacagttgctgtaacagatttcccaacaattctacagattcaa
atccagagagtatactatgatcgcgagcggttcatgccgttcaagtctgttgcaccattg
cctttcaatgaaactatttacatggataggtacagtgatactaataaccctgtgttgatt
aaccgcaaaagagagactgaaaaattggtgcaggaactcaatggcctgaagggaaggcaa
cgtgagctgttgagcaagaatgagttgggactatcaagaaagggtgctttaattgagact
tccaacttcttaaagtcagatgttcttgaaactcaaggcattcaaattgataacaggact
ggtctggcacaagaattagataatattgttttggggattaatgatgagttgtcgcagcta
tatcataatataacacaattagagagtaagatctctcatcagtttgatgactttaaaagc
ataggatactcacttttcgctgtattcattcacagaggagaggctagttatggtcattat
tggatttatatcaaggaccgttataaaagtggcatatggagaaaatacaacgatgaaact
atcacagaggttcctgagagtgaagtctttaatttctcagaggggaataccgctactcca
tattttctagtttacgtcaagcaaggtcatgaacaggagattgagcccttgaaaagagta
ttagaagtaactgtgtaa

DBGET integrated database retrieval system