KEGG   Zygosaccharomyces rouxii: ZYRO0G01958gHelp
Entry
ZYRO0G01958g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
zro  Zygosaccharomyces rouxii
Brite
Protein kinases [BR:zro01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   ZYRO0G01958g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:146015..153403
Genome map
AA seq 2462 aa AA seqDB search
MLSLRRKAGGHHHTRKKLTSSSRSADDISTTSAHDGGGIVTADGTRVTNGSGSDVKNYVD
NEASIAIVDSNFSTFNLIFDKLRSPIPQERIAASYELKTSLISLVREVSVEQFQRFSNKI
NNKIFELIHGSDPDEKIGGILAVDTLIGFYAHTEELPNQTSRLANYLRVLIPSNDIEVMR
LAANTLGKLAVPGGTLTSDFVEFEVKTCIEWLTTSPENSSSSSKQEYRKHASLLIITALA
NNSPYLLYPYVNSVLDNIWRALRDTKLVIGMDAAVTLGKCLSIIQDRDAPLTKQWVQRLF
KGCVYGLTLNTNESIHATLLVYRELLTLKGFYLDGKYDEIYQSTMTYKDHKYDVIRKEVY
AILPLLASFDPQLFANKYLDQTMVHYLTILNNMSTSAANHSDKSAILVSIGDIAYEVGSN
IMPYMDPILDNIRDGLQTKFKNRKKFEKELFYCIGKLACAVGAALSKHLNRGLLSLMLLC
PLSDYMQETLLIINEKIPALEPTINSSLLDLLCTSLSGDKFKQPGSPMSLKSLSIERARQ
WRNQSILRKTGEVNDDTNDAQILTQALRMLHTINHKSSLTEFVRLVVILYIEHENPHVRK
LAALTSCDLFVKDNICKQTSLHALNSVSEVLSKLLTVAITDPIADIRFEILQHLDSSFDP
QLAQPDNMRLLFMALNDEIFAIEMEAIRIIGRLTTVNPAYVVPSLRKTLLELLTELRYSN
MPRKKEESATLLCALISSSREVTKPYIEPILDVLLPKSKDGSSAVASTALKAVGELSVVG
GEDMKQYLSELMPLIINTFQDQSNSFKRDAALKTLGQLSASSGYVIDPLLDYPELLGVLI
NILKSESAQNIRRETVRLIGILGALDPYKHREVEVTSNAKISVEQNAPSIDIALLMQGMS
PSNEEYYPTVVINTLMKILRDSSLSSHHTAVIQAIMHIFQTLGLRCVQFLGQIIPGIITV
MHSCPPSLLEFYFQQLGLLVSIVKQHIRTHVDEMYEVIEEFFPITKLQITIISVIESISK
ALEGEFKRFVPNTLTFFLNVLENDKSNKKAVSIRILKSLVVFDSNLEDYAHLIIPTVVRM
AEYSPGTLRMMAVVTLGKLAKSINLSQMSSRIVQALVRVLNTEDRELVRATMNTLSLLLL
QLGADFTVFIPIINKTLVKNHIQHSIYDQLVNKLLNNEGLPTNILSDREFDNNKREPTEA
ESAAKKLPVNQLVLKNTWDCSQQRTKEDWQEWIRRLSIQLLKESPSHALRACSGLAGIYY
PLARELFNASFASCWTELYTQYQEDLIQSLCSALSSPQNPPEIHQTLLNLVEFMEHDDKP
LPIPIQTLGKYAQRCHAYAKALHYKEVEFIQEPSTSTIESLISINNQLHQTDAAIGILKH
AQRHHDLQLKETWYEKLQRWEDALTAYNQRENAGEDSLEVTMGKMRSLHALGEWEQLADL
SSEKWSISKPDVRNVMAPLAAGAAWGLGQWDKIEQYISVMKPQSPNKEFFDAVLSLHKNN
FDEAEKHIFNARDLLVTEISALINESYNRAYSVVVRSQIIAELEEIIKYKQLPLNSEKRI
MIRNTWNKRLLGCQKNVDVWQRVLRVRSLVVKPKQDMQVWIKFANLCRKSGRMGLAQKAL
NSLLEEGGDPEHPNTARAPPPVVYAQLKYLWATGSQKEALRHLIGFTSRMAHDLGLDPSN
MIAQSVPQNSIIAPHHVEDYTKLLARCFLKQGEWRISLQSNWRMENPDAILGSYLLATHF
DDNWYKAWHNWALANFEVISMITSGSKDKSINGLRPSTNGVYKIENGMMGSDTFTPEGNS
YPIELIQRHVVPAIKGFFHSISLSEASSLQDTLRLLTLWFTFGGIPEAAQAMHEGFSMIK
IGYWLEVLPQLIARIHQPDKVVSRSLLSLLSDFGKAHPQALVYPLTVAIKSESVSRQKAA
LSIIEKMRMHSPVLVDQAELVSHELIRVAVLWHELWYEGLEDASRQFFGEHNTEKMFATL
EPLHEMLKRGPETLREISFQNLFGRDLNDAYEWVLNFKRKKDVSNLNQAWDIYYNVFRRI
SRQLPQLQTLELQHVSPKLLMARDLELAVPGTYAAGKKIIRISRFEPVFSVISSKQRPRK
FSIKGSDGKDYQYVLKGHEDIRQDSLVMQLFGLVNTLLQNDSECFQRHLDIQQYPAIPLS
PKSGLLGWVPNSDTFHVLIREHREAKKIPLNIEHWVMLQMAPDYDNLTLLQKVEVFTYAL
DNTRGQDLYKVLWLKSRSSESWLERRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRNTG
KVIHIDFGDCFEAAILREKFPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMRVLRANN
ESLMAILEAFAFDPLIHWGFDLPTQTIMERTDIQMPLTNTSELLRKDVITVEEAAKMEIE
QKNEIRNARAMLVLRRITDKLTGNDFRRFQELNVPEQVDKLIQQATSVENLCQHYIGWCP
FW
NT seq 7389 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgcttagaagaaaagcaggaggccaccatcacacgagaaagaagcttacatcg
agctctcgatccgcagatgacatatctaccacttcggcgcatgatgggggtggtatagtg
acagcggacggtactagggtgaccaatggtagcggaagtgatgtgaagaactatgttgat
aatgaggcatcgattgcgattgttgatagcaatttttccacgtttaacctaatctttgac
aaattgagaagtcccataccacaggaaagaatagcggcatcatacgaattaaagacatct
ttaatatctctcgtaagagaagtttctgtggaacaatttcaaaggtttagtaacaagatt
aataacaagatttttgaattgatacacggttcagatcccgatgagaagattggtgggata
ttagcagttgatacgttaataggattttacgcgcatacggaggaattacccaatcaaact
tctagattggctaactatttaagggttcttatcccatccaatgatatcgaagtaatgaga
ttggctgccaatacgttggggaaattagcagtaccgggcggtactttaacttcagacttt
gtagaatttgaagtcaagacttgcattgaatggttaactacatcaccagaaaattcgtct
tcaagttcaaagcaggaatatagaaagcatgcatctttacttataatcacagcattggct
aataattcgccgtatctactttatccctatgtgaattcagtattagataacatctggaga
gctctaagggacaccaaattagtcattgggatggatgccgccgtaactttgggtaaatgc
ctttcgattatccaagatagagatgcacctttaaccaaacagtgggtacaaagacttttc
aaaggttgtgtttatggtttaactctgaatacaaatgaatccatccatgctactttactt
gtttacagagagttactcactttgaaaggattttacctggatggcaagtacgacgaaata
taccaatccacaatgacctataaagatcacaaatacgatgtcattcgtaaagaagtttat
gccattttaccattgctggcgtcatttgatcctcaattatttgctaataaatatttggat
caaactatggttcactatttgaccattttaaacaatatgagtaccagtgcagctaatcac
agcgataaatccgccatcttggtttctattggtgacattgcatacgaagtaggctcaaat
attatgccttatatggatccaatactggataacattagagatggtttacagactaaattc
aaaaacaggaaaaaatttgaaaaagaattgttctattgtatcggcaagctagcatgtgca
gtgggggcagcgctgtctaaacatctaaacaggggtctgctttctttaatgcttctatgc
ccattatctgactacatgcaggaaactttactcataattaatgaaaagatacccgctcta
gaacccactataaattccagcttactcgatttactctgtacttcactatcaggcgataag
ttcaagcaaccaggatcacctatgtcactcaaatctttatcaatcgaaagggcacgtcaa
tggagaaatcaaagcatattacgcaagacgggtgaagtaaatgacgacaccaatgatgca
caaattttgacacaggcactaagaatgcttcatacaattaaccacaagtcttccttaacg
gaatttgtcagattggtggtaatactttacattgaacatgaaaacccccatgtaagaaag
ttggcggcattaacttcatgtgatttgtttgttaaggataacatctgcaaacaaacatct
ttacatgcattaaattctgtctcagaagtgctaagcaaactgttaacagtagctatcaca
gatccaatagcagacataaggtttgaaatcttacaacatttagattctagctttgatccg
caattagcacagccagacaacatgaggcttctattcatggctttaaatgatgaaattttt
gcaattgaaatggaggctatccgaataataggtagactcacgacagtgaacccagcatac
gtggttccatcactgaggaaaacattattagagctactgacagaattgaggtactccaac
atgccgcggaaaaaagaagaaagtgcaactttactttgtgcactcatcagctctagtaga
gaggtaaccaagccatacattgagccgattttggacgttttgttacccaaatccaaggac
ggctcttcggctgtagcttctactgctctcaaagctgttggtgaactttcagttgtaggt
ggtgaagatatgaagcagtatttgagtgagttaatgcctctaattataaatactttccaa
gatcaatctaattcattcaaaagggatgcagcccttaagaccttaggtcaattgtctgca
tcttctggttacgtcattgatccactattagactatccagaactgttaggtgttttaatc
aacatcttgaaatcagagagtgctcaaaatataagaagggaaaccgtacggctaataggt
atattaggtgctcttgatccatacaagcatagagaagtggaagttacctcaaatgcaaag
atttctgttgaacagaatgcaccatctatcgatatcgccctgttgatgcaaggtatgtca
ccatctaatgaggagtactacccaactgttgtaattaacacactgatgaagatactacgt
gattcatctttatcatcccatcacactgccgttatccaggcaatcatgcatattttccaa
acccttggtcttcgttgcgtccaatttttgggtcaaattataccaggtatcataacagtc
atgcattcttgtcctccttcattgctcgaattttatttccaacagctgggccttctagtg
tccatcgtcaaacaacacatcaggactcacgttgatgaaatgtacgaagtgattgaggaa
tttttccccataaccaaattgcaaattactatcatatcagtcatcgaatctatttctaaa
gcattggaaggtgaattcaaaagatttgtccccaatactttgacctttttcttgaatgtt
ttggaaaatgataaatcgaataaaaaggcggtgtctattaggattttgaagtctctggtc
gtatttgatagtaatctagaggactatgcacatctgatcattccaacagtcgtcagaatg
gcagaatattctcccggtactttgagaatgatggcggttgttaccttagggaaattagcc
aaaagcattaacctttctcaaatgtcatctcgtattgtgcaagcgctggtacgcgtcctg
aatacggaagatagagaacttgtcagagctaccatgaacactttgagtttgcttcttctt
cagctaggtgctgatttcacagtgttcatacctataattaacaagacattagtgaaaaac
cacattcaacattcaatttacgatcagctggttaacaaactattaaataatgaaggtttg
ccaacgaacattttatctgatagagaatttgataacaataagagagaaccgactgaagct
gaatctgccgcgaagaaactacctgttaatcaattggtcttgaagaatacttgggattgc
agtcagcagaggacgaaagaagattggcaagaatggattagaagactatccatccaactt
ttgaaggaatcaccttcacatgcattaagagcatgttctggtctagcaggaatttactac
ccattagccagagaattgtttaacgcgtcattcgctagctgctggactgagctatataca
caataccaagaggatttgattcagtcactttgctcagctctttcttcgcctcaaaacccc
ccagaaatccatcagactcttctgaacttggtggaattcatggagcatgatgataaacca
ctacctattcccattcaaaccttaggtaaatacgctcaacgatgtcacgcatatgctaag
gcattacattacaaagaagttgaatttatccaggaaccttccacttccactattgagtca
ttaataagcatcaataatcagcttcaccaaacagatgcagctatcggtatactaaagcat
gcacagagacaccatgatctgcaactaaaagaaacttggtatgaaaaactacagaggtgg
gaagatgctctgactgcgtataatcaaagggagaatgctggtgaggattcgctggaagtc
accatgggtaaaatgagatccctacatgctcttggtgagtgggaacaattggccgaccta
tcatctgaaaaatggtccatctctaagcctgacgttcgtaatgttatggcaccattagct
gctggtgcagcatggggtctaggacagtgggataaaatcgaacagtacatcagtgttatg
aaaccacagtctccaaataaagaattttttgatgctgtattgagtttgcataagaataat
tttgatgaagctgaaaagcatatctttaatgcccgtgatctgttggttaccgagatatct
gccttgatcaatgaaagttacaatagagcgtacagcgttgtcgtgagatcccaaataatt
gcagaattggaggagattatcaaatataagcagttacctctaaattcggagaaacgtatt
atgatcaggaacacttggaataaaaggctattaggttgccagaaaaatgtggatgtatgg
caaagagtgctaagggtacgttccttggtggttaaaccaaaacaagacatgcaagtgtgg
atcaaatttgccaacttgtgtagaaaatcaggaagaatgggtttggctcaaaaggcacta
aactctcttctagaagaaggtggagatcctgagcatcctaatacagctagagctcctcca
cctgttgtgtatgcacaactgaaatacttgtgggctacaggttcgcagaaggaggcactt
cgtcatttgattggcttcacatcaagaatggctcatgatctgggtcttgaccccagcaac
atgatcgctcaaagtgtcccacaaaatagcatcattgctcctcatcatgtagaggattac
actaaactcttggcacgctgtttcctgaaacaaggtgaatggaggatttcactacaatca
aactggagaatggaaaatcctgatgctatccttggttcttaccttttggccactcatttc
gatgacaattggtataaagcatggcacaattgggctttagctaactttgaagtgatttcg
atgataacttcaggctcgaaggataaatcaataaatggtcttcgtccatcgacaaacggt
gtttataaaattgaaaatggcatgatgggatccgatacgtttactccagaggggaacagt
tacccaatagaattgatacagagacatgttgttccagcaatcaagggatttttccattcg
atctctctatctgaagctagttctctccaggatactttgagacttttgactctatggttc
acctttggtggtattccagaggccgcccaggctatgcatgaagggttcagcatgatcaaa
attggatattggttagaggttttacctcaattgattgcacgtatccatcaaccagacaaa
gtggttagtagatccttgttatcacttctttcagatttcggtaaagcgcatcctcaagcg
ttggtttatccattgacagtcgcaattaaatcagaatctgtttctagacagaaagcagct
ctatccatcatagagaaaatgagaatgcacagtccagttctggttgatcaagctgaacta
gttagtcatgaattgatccgcgtggcagtattgtggcatgagttatggtatgaaggttta
gaagacgccagtagacagttcttcggtgaacacaacacagaaaagatgtttgcgactttg
gaacctttgcatgagatgttgaaacgtggccctgagaccttgagagaaatttcattccag
aatttatttggtagagatcttaacgacgcttatgagtgggtcttaaatttcaaacgtaaa
aaggatgtgagtaatttgaatcaagcgtgggacatatactacaatgtctttagaagaatc
agcagacagctaccacagttacaaacgttggaacttcaacatgtttcacctaagttatta
atggctcgcgatttggagctagctgtgcctggtacctatgccgcaggtaaaaagattatc
aggatttcaagatttgaacccgtattctcagttatatcttcgaagcaaaggcctcgtaaa
ttttctatcaaaggcagcgatggtaaggattaccagtacgttttgaaaggtcacgaagat
attagacaagatagtttggtcatgcaattatttggattagtgaatacattgttacaaaat
gattctgaatgtttccaaagacatttagatatccaacagtaccctgctattccactttca
cctaaatctggtcttctcggttgggttcctaacagtgatactttccacgttcttatccgt
gaacatcgtgaagctaaaaagatacctctcaacattgagcactgggttatgctgcaaatg
gctcctgattatgataacttaactttactacaaaaggtggaagtatttacctatgcactt
gacaatacgagaggtcaggatctttacaaagtcctatggttaaagagtagatcctccgaa
tcctggctagaacgtagaacaacatacacgaggtctttagccgtaatgtcaatggtcggt
tacatattaggtcttggtgatcgtcatccaagcaatttgatgttggacaggaatacaggt
aaagttatccacatcgattttggtgattgtttcgaagccgccattctaagagagaaattc
cctgaaaaagttccattcagactgacaagaatgctgacctatgctatggaagttagtgga
attgaaggtagtttccgtattacttgtgaaaacgtgatgcgtgtcttgagagctaataac
gaatctttgatggctatcttggaagcttttgcattcgatcctttgattcattgggggttc
gatctaccaacacagactattatggaacggactgatatccaaatgcctctaacaaacaca
agtgaactgttgaggaaagatgtaattactgtggaggaagcagccaagatggagatagaa
cagaaaaatgaaatcagaaacgcaagagccatgctagttctgagacgtattaccgataaa
ctaactggtaacgatttccgtaggttccaagagttgaacgttcctgagcaggtggataaa
ctaattcaacaagcaacctctgtagaaaacctttgccagcattacatcggatggtgtcca
ttctggtga

DBGET integrated database retrieval system