KEGG   Zygosaccharomyces rouxii: ZYRO0G02376gHelp
Entry
ZYRO0G02376g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZYRO0G02376g
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZYRO0G02376g
Enzymes [BR:zro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ZYRO0G02376g
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     ZYRO0G02376g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:180544..182091
Genome map
AA seq 515 aa AA seqDB search
MTNIITSMKTHQYSSILEIIPLIPPSKALHINMAARKVILIDNYDSFTWNVYQYLCEGGA
DVEVYRNDKITVDGIIALNPDMLVISPGPGHPKTDSGISRDCIRKFAGKIPIFGICMGEQ
CMFDVFGGQVEYAGEIVHGKTSLVNHDNKGLFKNIPQGVAVTRYHSLAGSAVTVPEELEV
SATLENGIIMGVRHKKYTIEGVQFHPESILTEEGHLMIENMLNVYGGTWEENEKKDTRGQ
SGSILDRIYAQRREDVDAQSHIAGFTTKDLETNFQLGLAPTVQDFYQRLKNSPGRAAVLA
EVKRASPSKGDICPDANSAQQALRYAKAGAATISVLTEPHWFKGSLQDMINVRKALDVEF
SSNPKGRPCVLRKEFVFCKYQILEARLAGADTVLLIVKMLSQDELVELYQYATKEMGFEP
LVEVNTKQEMERALQIGAKIIGVNNRDLHSFTVDLDTTSNLVDSVPKDVLLIALSGITTA
QDAEKYKSEGVHGFLVGEALMRSSDPSTFIRQLTA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatattataaccagtatgaagactcatcaatactcatcaatactcgagattatt
ccacttatacctccatccaaggctcttcatatcaatatggcagctcgtaaagtgatttta
atcgataactacgattcatttacctggaacgtttaccaatacctttgtgaaggaggtgcc
gatgtcgaagtgtaccgtaatgataaaattactgttgatggtattattgccttaaaccct
gatatgttggtgatatcacctggtcctggtcacccaaaaacagattcaggtatctctaga
gactgcataagaaaatttgctggtaagatccccatctttggtatatgcatgggggaacaa
tgtatgtttgacgtattcggtggtcaagtggaatacgctggtgaaattgttcacggtaag
acttctctagtgaaccacgataataaaggtcttttcaaaaatattcctcaaggtgtggcg
gttaccagataccattctttggccggtagtgcagttacagtcccagaggaactggaagta
tccgccacattagaaaatgggattattatgggtgtaagacataagaagtatacgatagag
ggagtccaattccacccggaatcgattcttaccgaagaaggacacctaatgattgaaaac
atgctaaatgtgtatggtggtacttgggaagaaaatgagaagaaggacaccagggggcaa
agtggatccattcttgatcggatttatgcccagcgtcgtgaggatgtagacgctcagagt
catatcgcaggttttacaacaaaagatttggagacaaatttccagttaggattggcgccc
actgtacaagatttctaccaaagattgaaaaatagtcctggtagggccgctgttctggct
gaagtgaaacgtgcgtcgccttccaagggtgatatctgtcccgatgctaattctgctcaa
caagcattgagatacgctaaagccggtgcagccaccatatcggtactcacagaaccacac
tggttcaaaggtagtttgcaggatatgatcaatgtcagaaaggctttagacgtggaattt
agctcgaatcccaaagggagaccatgtgttctacgcaaagagttcgtgttctgcaaatac
caaattttagaggcaagattggctggtgcggataccgttcttttgattgttaagatgctt
tcacaggatgaactggtggaattatatcaatacgccacaaaggaaatggggtttgaacca
ttggtggaagttaacacaaaacaagagatggaacgtgctcttcagattggcgccaagatc
attggtgttaacaatagagatttacattctttcacggttgacttggatacaactagtaat
ttggtggattctgtaccaaaggacgttttattaattgcactttctggtattactacagcc
caggatgccgagaagtataaaagtgagggggttcacggattcttagtcggtgaagctctg
atgagaagctctgacccaagcactttcatccgccaattaacagcataa

DBGET integrated database retrieval system