KEGG   Zygosaccharomyces rouxii: ZYRO0G02794gHelp
Entry
ZYRO0G02794g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00010  Glycolysis / Gluconeogenesis
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
zro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0G02794g
Enzymes [BR:zro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ZYRO0G02794g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 8205911
NCBI-ProteinID: XP_002498123
UniProt: C5DZA6
Position
G:complement(212229..213119)
Genome map
AA seq 296 aa AA seqDB search
MSVEDLGDRVVLTHPDDKSNTATILKYGATVFSWKLNGAEQLWLSDAAKLDGSRPVRGGI
PLVFPVFGKNTTDDHLSKLPQHGLARNSTWEFLGQTKSNPPTVQFALSPENANKELTQLW
PFDFTLLLTVQLGQDYLKTDIEVQNPSTTQELKFNWLFHTYLKIEDIEGTLVSNLTGVKL
YDQLLKQSYIDKHPVITVSDETDLIYQNVDENRLIQVVDRGQPVHTVKRHNLPDAVVWNP
WTEKAGGMADFEPKDGYLQMVCIEPGHVHDLVTLAPGQSWSAYQLLYKEQLKYQAI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaagatctaggtgacagagttgtcttaacccatcctgatgataagagcaac
acagctaccattttgaaatatggtgcaacagttttcagttggaagctgaacggggctgaa
caattatggttatctgatgctgctaaattagatggtagtagacccgtaagaggtggtatt
ccattggttttccccgtctttggtaagaacactacggatgatcatttgagtaaactacca
caacacgggttggcaagaaattcaacatgggaattcctaggtcaaacgaaatcgaaccct
cctaccgtccaatttgcattgtcacctgaaaatgccaacaaggagttgacccaattgtgg
ccgtttgatttcactctattgttaaccgttcaattgggccaggactatttgaagactgac
attgaagttcaaaatccttcaacaacacaagaattgaaatttaactggctattccatacc
tatttgaagattgaagacatcgaaggcactctggtctccaatctgacaggcgtaaaactg
tacgatcaattgttgaagcaatcttatattgataagcaccctgtgataaccgttagcgat
gaaactgatttgatctatcaaaatgtagatgaaaaccgtttgattcaagtcgtcgacaga
ggacaaccagtccataccgtcaagagacataacctacctgacgctgtcgtttggaatcca
tggactgaaaaagccggcggtatggccgattttgaaccaaaggacggctatttacaaatg
gtttgtatcgagcctggtcatgttcatgatttggttactttggcaccaggccaatcttgg
tccgcataccaactgctctacaaagaacaactaaagtaccaagcaatctaa

DBGET integrated database retrieval system