KEGG   Zygosaccharomyces rouxii: ZYRO0G05610gHelp
Entry
ZYRO0G05610g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZYRO0G05610g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ZYRO0G05610g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:444743..445837
Genome map
AA seq 364 aa AA seqDB search
MRFSTLASLAALFEFTTAGRWTEDWPFAGFPSFAKLPFHTCLVDNPEFDIALIGVPFDTA
VSFRPGARFGPQAIRRASQRQNGLRGFNARAGINPYDNWAHIIDCGDIPVTPMDNQLALE
QMNAAYDELVNGTTTSGNTAGALPRLVSLGGDHSVILPALRALHKHYGPISVIHLDSHLD
TWSPDSYPSYWHSNTSEFTHGSMLWLAAQEGLINKGHCVHGGLRTRLSGDDWSDYEEDDR
VGFHRIHADEMMEIGPRGIAERIKQIVPKNVPVYLSVDIDVLDPSAAPGTGTVEPGGWLT
RELISLIRQLQDLPLVGADVVEVSPPFDHADVTAMAAAQVAYEIITNMVKTPLELETRKF
FSNM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttctcaacgcttgctagcttagctgctctctttgagttcactacggctggtaga
tggactgaagattggccgtttgcaggtttcccctcatttgcaaaactgccatttcataca
tgtttagtcgataatccagaatttgacattgcactgattggtgtcccgttcgacactgca
gtgtctttccgtccaggtgcaagattcggtcctcaagcaattcgccgagcttcacagcgt
caaaacggtttacgagggtttaatgctcgtgctggtattaacccctatgacaactgggcc
catatcatagactgcggtgacattcctgtcacgccaatggataatcaattggcgttagaa
caaatgaatgcagcttatgatgaattggttaatgggacaactactagtggtaataccgct
ggagcattaccaagacttgtgtctcttggtggagatcattcagtgattttgccagcattg
agagccctacacaagcactacggtcccatttctgtaattcatctggattctcatcttgat
acctggtcaccggacagctatccatcctactggcatagcaatacttcggagtttacacat
ggttctatgttgtggttagcagcacaagaaggtttgataaacaaaggccactgtgtccat
gggggacttcgcacaagacttagcggtgacgactggtccgactacgaggaggacgataga
gttggtttccacagaatccacgcggacgaaatgatggaaataggacctcgtggcatagct
gaacgtatcaaacaaattgtgcctaagaacgtcccagtttacctaagtgtagatatcgac
gtattggatccaagtgctgcaccgggaacaggtaccgtggaaccaggtggatggctcaca
agagaactaatctcactaattcgccagcttcaagatttaccacttgtcggagcagatgtt
gtagaagtttcgccaccatttgatcatgcagatgtaaccgcaatggctgctgcacaagta
gcctacgagatcatcaccaacatggtgaagacacctttagagctagagacaagaaagttt
ttctcaaatatgtaa

DBGET integrated database retrieval system