KEGG   Zygosaccharomyces rouxii: ZYRO0G06798gHelp
Entry
ZYRO0G06798g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:zro00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ZYRO0G06798g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ZYRO0G06798g
Peptidases [BR:zro01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ZYRO0G06798g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:544095..546728
Genome map
AA seq 877 aa AA seqDB search
MSSSKLRCKSISKLSNVAEQFMIQDSRCGPGARVMTLLQVCLDTLEAYKDEYKKLKRNDE
VSQEQIYHIYESAYVYYKIVHSLVLNRIPNLNEFHQVKRRSNTSDKKLMEIYNMLVKSLL
YDEKISGVKTFIKEHSSDIDEISSDKELKTGGFISAKELEFLLKSDDRNILLVDVRQRSE
FEETHIKASNVICIEPISFKSSYTDLELEKKSMITSPNVEIDIFKRRNEFTFVILYTDGN
KENGHHNFYIQQEMVLLDLLINRSFAKPLHKDVKILVLEAGISSWKFHGGSCSSSENFQG
NQDSGAIYINGNTSGLKLQQLPKLTPNISSSMDSSMKDMMRSTSQDPSNAGFNLPIQQRP
PGSANLINPSPSVSPSQLPLGSPPLSHHPDMKFAKYPTTPQLADKDNANDSNGTANGTAN
GGSSAGNGLPTFTNVSPINSRAVAPARRTIASPNPPSILVGSSATNGTSANTSTNQPLSK
PPTQPLPTLPQLPTRSSNSQSSLTQTKQYDLDFTVGLENMGNSCYINCIIQCLLGTHELT
NIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQMHQSAAFKKSDKNKAVRPYEFKMACG
SINSLFRESGQQDSQEFCQFLLDGLHEDLNQCGGNPPLKELSEEAEKMRERLSMRIASSI
EWERYLTRDFSVIVDLFQGQYASQLRCKVCNHTSTTYQPFSILAAPVPHAKSCYLLDCFK
EFTKLEQLEKDEEWLCPYCKKKQPSTKKLTITRLPRNLIIHLKRFDNLLNKNNVLVNYPF
FLDLTPFWANDFDGRLPPGVTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGL
NKGWYYFDDTGYRPMRTPTECITSNAYVLFYHRVYGV
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagttctaagctgcgttgtaaatctatttcaaaactatcaaatgtggctgaacag
tttatgattcaagattcgagatgtgggcctggggctcgtgtaatgactcttttgcaagta
tgtttagacaccttagaggcctataaggatgaatataagaaattgaaaaggaatgatgag
gtgtctcaagaacaaatctatcatatctacgaatctgcatatgtttattataagatcgta
cacagtttggttcttaatagaataccgaatctcaatgaattccatcaggtcaaaaggcgc
tccaacacaagtgataaaaaattgatggagatttataatatgttggttaaaagtttgctc
tatgacgaaaagatcagtggcgttaaaacgtttatcaaggagcattcttctgatattgat
gaaattagtagtgataaagaactgaaaaccggtggttttatttcagcaaaggagttggaa
tttttgcttaaatctgacgatcgtaatattttgctagtggatgtaagacagagatctgaa
tttgaagaaacccatattaaagccagtaatgtcatttgcatcgagccaatatcatttaag
agttcctacacagatctggaattggagaaaaaatcgatgattacttcaccaaatgttgaa
attgatatttttaagaggagaaatgagtttacgtttgtcattctatatacagatggcaat
aaagaaaatggtcaccataatttttacatccaacaggaaatggtgttattagacttactg
ataaacagatcatttgccaaaccacttcataaggatgttaaaattctagtattagaggca
ggaatctctagttggaaatttcatggtggtagttgtagtagtagtgaaaacttccaagga
aaccaagacagcggcgctatctatattaatggtaatacttcaggtttaaagctgcaacaa
ctgccaaaattgacgcctaatattagctcctcgatggattcttcaatgaaagatatgatg
agatcaacttcgcaagatccaagtaatgccggctttaatttacctatacagcaaagacca
cctggatctgcaaacctaataaacccctctccctctgtatctccttctcaattgccactt
gggtcgccacctttgtctcatcatccagacatgaaattcgccaaatatccaactactcca
caattagccgacaaagataatgcgaatgacagtaatggcactgctaatggtactgctaat
ggtggtagcagtgctggtaatggattgcctacgttcaccaatgtttcacctataaattca
agagcggttgcgcctgcacgtcgtaccattgcgtcacccaacccaccaagcattttggtg
ggtagtagtgcaactaatggtactagtgctaatactagtaccaatcaacctttatcaaaa
cctccaacccaaccattaccaacattgccgcaattaccaacacgctcatctaattcacaa
agttcattaacacagacaaaacagtacgatttagattttacagttggattagaaaatatg
ggtaattcatgttatatcaattgtatcatacaatgccttttaggtactcacgaattaacg
aatattttcctcaacaattcttatgaacgtcatatcaatttaaacagtaaattgggatcc
aagggcgttttagctaaacattttgccagattaattcatcaaatgcatcaaagcgctgca
tttaaaaagtcagataaaaataaagctgttagaccctatgaattcaaaatggcttgcggt
tcgataaattccctttttagagaaagtggtcaacaggattctcaagaattttgtcaattt
ttgttagatggattacatgaagatttaaaccaatgtggtggtaatcctccattaaaagaa
ttatcagaagaagctgaaaaaatgagagaaagattatcgatgagaatcgcgtcttccatt
gagtgggagaggtatttgacaagagatttcagcgttatcgttgatttgttccaagggcaa
tacgcttcgcaattgaggtgcaaagtttgtaatcatacttctacaacttatcagcctttt
tctatactagcggccccggtacctcacgctaaaagttgttacttattggattgcttcaag
gaatttacaaagttagaacagttggaaaaagatgaagaatggctatgtccctattgtaag
aaaaagcaaccttcgactaaaaaattgacaatcacaaggttaccgcgcaatctgattatt
cacttgaaaagatttgataatttgttgaacaaaaataacgttttggtcaattatccattc
tttttggatttaactccattttgggcaaatgattttgacgggagattaccacctggggtt
actgatgaattgccttcaaggggtcaagttgcaccatttaaatataaattatacgcagtt
gcgtcacattcgggtagcctttacggtggtcattataccgcttatgtggataaaggcttg
aacaagggctggtactattttgatgataccggttatcgtccaatgagaactccaacggaa
tgtatcacatcaaatgcatacgtcttgttttaccatcgtgtatacggtgtttaa

DBGET integrated database retrieval system