KEGG   Zygosaccharomyces rouxii: ZYRO0G07700gHelp
Entry
ZYRO0G07700g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
zro  Zygosaccharomyces rouxii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ZYRO0G07700g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ZYRO0G07700g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZYRO0G07700g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(609766..611880)
Genome map
AA seq 704 aa AA seqDB search
MSQDINRLTVDGVVPLIATVDVGTTSSRAILFNRLGQEVSKHQIEYSTTASKEKYGASGK
RRPSFDRNPDDPIFTAEGIAIKETKYVEIEDLKQPDPTLRFPRPGWVECKPINILENVEE
CLAKAFSFVWSVNEQRQQDGLPPYRVHAMGIANMRETTIVWSKETGLPVVDYGIVWNDTR
NAGIVAEMKKNTPKEKQERLQEKIGLPLYSTYFSCSKLRWLLDNEPAVQKSYGEGDLMFG
TVDTWLIYHLTHNHAFISDVTNASRTGFMNLDTLDYDDELLSYWGIDKTKINLPRITSSA
EYFGDFKVPEVTKSWMDPSDWDILEKLSNRGPPIPVQGCLGDQSSSLVGQLAFKPGAAKC
TYGTGCFLLFNTGSKKLISKHGALTTFGYWFPHLEGDDKNSPHFALEGSVAVAGAVVQWL
RDNLRLIPKAEDVGPLACRVPDSGGVVFVPAFSGLFAPYWDADARATIMGMSQHTTASHI
ARAAVEGVCFQARAILSAMSADALGEGKRDKEFLNEMEDDSEEKSALSTLAVDGGMSKSD
EVMQIQADILGPCTKVRRSPTSECTALGAAIAAEMGFKDPKDRIMWKDLKDVKKWVFYNG
IPKGEAVPAELMPNLKLFVSDSDDAERRHKRRLWDIAVRRTRGWMAAVYPPNSNVNEGFQ
TDGLAVESPAVQPENSPFIPPKHENLEREMHRKELRKQRNALKV
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagacattaatagattaactgttgatggagtagttccactaatagcaacagta
gatgtggggactacatcatctcgtgcaattctgtttaacagattaggtcaagaggtttct
aaacaccaaattgaatactctactactgcatctaaggaaaagtacggtgcatctggtaag
cgcaggccatcatttgatcggaatcctgatgatcctatcttcactgctgaaggtattgca
attaaagagacaaaatatgtggagatcgaagatttgaagcaaccagatccaactttaagg
ttcccacgtcctggatgggtagaatgcaaaccaattaatattttggaaaatgttgaagaa
tgtctagcaaaggctttttcatttgtatggtctgttaatgaacaaagacaacaagatgga
ttaccaccttacagagtacacgcaatgggtattgccaatatgagagaaactactattgtt
tggtcaaaggagactgggttaccggttgtcgattatggtattgtgtggaatgatactaga
aatgcaggtattgtggcagaaatgaagaaaaatacaccaaaggagaaacaagaaaggttg
caagaaaaaatcgggttgccgctgtacagtacatatttttcatgttccaaattacgttgg
cttttggacaatgaaccagctgtacaaaagagttatggagaaggtgatttgatgtttggt
actgtagatacttggttaatttatcatttaactcacaaccatgcatttatttctgatgtt
actaatgcgtcacgtactggttttatgaatttggatactttagattatgacgatgaatta
ttgagctattgggggattgataagacaaagatcaacttacctaggattacgtcatcggcc
gaatactttggagattttaaagttcctgaagttactaaaagttggatggatcctagtgat
tgggatattctagaaaaattatcaaatagaggaccgccaattccagtgcaaggttgccta
ggtgaccaatcaagttctcttgttggtcaattggcctttaaaccaggtgcagctaaatgt
acctatggtacaggttgtttcttactgtttaatactggttctaagaaattaatttctaaa
catggtgctttgacgacatttggttactggtttcctcatttagaaggtgatgataagaat
tctccacattttgcgcttgaaggttctgtcgcagttgcaggtgcggtcgtccagtggtta
agagataatttgagattaattccaaaggctgaagatgtcggacccttagcatgccgtgta
cctgattctggtggtgttgtatttgttcctgcgttttctggattgtttgcaccatattgg
gatgctgatgctagggctactattatgggtatgtctcaacataccactgcgtctcatatt
gcaagagccgctgtcgaaggtgtttgtttccaagcgcgtgctattttatctgcaatgtct
gctgatgcccttggtgaaggtaaaagggacaaagaatttttgaatgaaatggaagatgat
tctgaggagaaaagtgcactttcaacattagcggttgatggtggtatgtcaaaatctgat
gaagttatgcaaattcaagcagatattttaggcccatgtactaaagtaaggagatctcca
acttcagagtgtactgcactaggcgcagctattgcagcagaaatgggatttaaagatcca
aaggatagaattatgtggaaagatctaaaggatgtcaaaaaatgggttttctataatgga
attcctaaaggtgaagctgttccagcagaattaatgccaaatcttaaactgttcgtttcc
gatagtgatgatgcagaaagaagacacaagaggagattatgggatattgcagttcggaga
acaagaggttggatggctgcagtttatccaccaaattccaatgtaaacgaaggtttccaa
acagatggattagctgtggaatcaccagcggttcaacctgaaaattcgccatttatccct
ccaaagcatgaaaatttggaaagagaaatgcacaggaaagaattaagaaagcaacgaaat
gctttgaaggtctga

DBGET integrated database retrieval system